DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx1A and stx11b.1

DIOPT Version :9

Sequence 1:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_957156.1 Gene:stx11b.1 / 393836 ZFINID:ZDB-GENE-040426-1893 Length:295 Species:Danio rerio


Alignment Length:256 Identity:86/256 - (33%)
Similarity:144/256 - (56%) Gaps:17/256 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDRLAALHAAQSDD----EEETEVAVNVDGHDSYMDD--FFAQVEEIRGMIDKVQD--------- 52
            :|||..|......|    |.|::...|||..:::...  .|...|::..::|:.||         
Zfish     2 RDRLNHLLTISETDSHLEEVESDSFSNVDLEENFSQQAVIFDNGEDMESVLDEAQDTRREIQLIR 66

  Fly    53 -NVEEVKKKHSAILSAPQTDEKTKQELEDLMADIKKNANRVRGKLKGIEQNI-EQEEQQNKSSAD 115
             .|:.::.:::.||:.|......|::...:..|||.....|..:|:.::.:. |.:|:...:||.
Zfish    67 LEVKRLRDQNTRILNEPTRTSYVKRDANAIAGDIKTRGVDVLARLQKMDAHAKELQEEHGINSAV 131

  Fly   116 LRIRKTQHSTLSRKFVEVMTEYNRTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNSSVF 180
            .||.:||::|||..|.:.|||||..:.:::|.||..||||:||.||..:.|::|:|||.|..:||
Zfish   132 ARIARTQYATLSNNFQDAMTEYNDAEMNHKESCKRHIQRQMEIVGREVSGDQIEEMLENGEWNVF 196

  Fly   181 TQGIIMETQQAKQTLADIEARHQDIMKLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVE 241
            ...|:.|.:.|:..|..||.||:::::||..:..||::|:|:|||||.||.|.|.|..:|:
Zfish   197 NDNIMSEGKTARSALNQIEHRHRELLELENRLNSLHEVFLDVAMLVEEQGPMTDYILNNVQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 70/209 (33%)
SNARE 231..281 CDD:399038 4/11 (36%)
stx11b.1NP_957156.1 Syntaxin 48..246 CDD:279182 68/197 (35%)
SynN 48..200 CDD:238105 49/151 (32%)
SNARE 210..266 CDD:304603 22/48 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 1 1.000 - - FOG0000185
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.