DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx1A and Syx17

DIOPT Version :9

Sequence 1:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001261414.1 Gene:Syx17 / 38541 FlyBaseID:FBgn0035540 Length:346 Species:Drosophila melanogaster


Alignment Length:294 Identity:62/294 - (21%)
Similarity:111/294 - (37%) Gaps:75/294 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKDRLAALHAAQSDDEEETEVAVNVDGHDSYMDDFFAQVEEIRGMIDKVQDNVEE------VKK 59
            ||:|....|..|:...:...:||  |..|.|.:.:..:.:|:...:.|..:...||      :|:
  Fly     1 MTRDEKLPLKQAEVSIQRFQDVA--VPHHLSLLKNHRSNIEKSLALGDWQKIKKEELNAMRVIKQ 63

  Fly    60 KHSAILSAPQTDEKTKQE----LEDLMADIKKNANRVRGKLKGIEQNIEQEEQQNKSSADLRIRK 120
            ..:.:|......||.::|    .:|||...:..|      ..|:           |..|:|:: |
  Fly    64 IKNLLLEMDALREKVREEDLERFDDLMKPGRDTA------FAGM-----------KEFAELQL-K 110

  Fly   121 TQHSTLSRKFVEVMTEYNRTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNSSVF----- 180
            :..||||.::                                  ||:|:...:|.:.:..     
  Fly   111 SPTSTLSSQY----------------------------------DDDLDNQPQEVDMNSLPAHRH 141

  Fly   181 TQGIIMETQQAKQTLADIEARHQDIMKLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVEHAMD 245
            ...:.:..|..:..||..:|....:..|:..|.:||.||..|..|...|...:::|..:.|.|::
  Fly   142 MPQLQLNFQLEEHQLAQRQACLDQMENLQQEIYDLHGMFQGMRQLTAEQSVAVEKIADNAEEALE 206

  Fly   246 YVQTATQDTKKALKYQSKARRKKIMILICLTVLG 279
            .||....:.::||.|      ||.|..:...:||
  Fly   207 NVQQGELNLRRALTY------KKAMYPVVGALLG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 38/211 (18%)
SNARE 231..281 CDD:399038 13/49 (27%)
Syx17NP_001261414.1 SNARE_syntaxin17 156..217 CDD:277199 17/60 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467316
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.