DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx1A and stx4

DIOPT Version :9

Sequence 1:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_956515.1 Gene:stx4 / 323735 ZFINID:ZDB-GENE-030131-2455 Length:297 Species:Danio rerio


Alignment Length:290 Identity:121/290 - (41%)
Similarity:185/290 - (63%) Gaps:11/290 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDRLAAL-HAAQSDDEEETEVAVNVD-------GHDSYMDDFFAQVEEIRGMIDKVQDNVEEVKK 59
            :||...| :.|.:.||:|..||:.:.       ..|...:.||.:|:|||..::.::..|.|::.
Zfish     2 RDRTKELGNTADASDEDEETVALMIKPGSGTSANEDKENEAFFKKVQEIREGLETLKRKVSELEN 66

  Fly    60 KHSAILSAPQTDEKTKQELEDLMADIKKNANRVRGKLKGIE-QNIEQEEQQNKSSADLRIRKTQH 123
            |...:|.....::..|:||:.|..|||..|::::.|||.:| :.:|.||:.  ...::|:|:|||
Zfish    67 KQKTVLGVALPEDSMKKELQSLREDIKGMASQIQKKLKSLEPKKLEVEEKY--IPVNVRMRRTQH 129

  Fly   124 STLSRKFVEVMTEYNRTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNSSVFTQGIIMET 188
            ..|||:|:|:|...|..|..||:|...||:|||:|||...:|||||.|||.|.:.||||.|:.:.
Zfish   130 GVLSREFLELMGRCNTIQAQYRDRNVERIKRQLKITGNSVSDDELETMLESGQTDVFTQNILNDA 194

  Fly   189 QQAKQTLADIEARHQDIMKLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVEHAMDYVQTATQD 253
            :..:|.|.:||:||.:|:|||.|||||||||..:||.||:||||:||||.:::.:.|||:.|..:
Zfish   195 KATRQALNEIESRHDEIIKLERSIKELHDMFQYLAMEVEAQGEMVDRIESNIKMSHDYVEKAVAE 259

  Fly   254 TKKALKYQSKARRKKIMILICLTVLGILAA 283
            |:.|:|...|.::|||.|.:||.||.::.|
Zfish   260 TEAAVKTSKKVQKKKIYIAVCLAVLLLIIA 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 86/197 (44%)
SNARE 231..281 CDD:399038 22/49 (45%)
stx4NP_956515.1 Syntaxin 41..236 CDD:279182 86/196 (44%)
SynN 41..190 CDD:238105 62/150 (41%)
SNARE_syntaxin4 200..262 CDD:277236 35/61 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595403
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 1 1.000 - - FOG0000185
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1024
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.