DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx1A and Stx2

DIOPT Version :9

Sequence 1:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_036880.1 Gene:Stx2 / 25130 RGDID:2558 Length:290 Species:Rattus norvegicus


Alignment Length:281 Identity:165/281 - (58%)
Similarity:215/281 - (76%) Gaps:2/281 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDRLAALHAAQSDDEEETEVAVNVDGHDSYMDDFFAQVEEIRGMIDKVQDNVEEVKKKHSAILSA 67
            :|||..|.|.:..|:.:..|.:.|: .|.:||.||.||||||..|.::..:||:|||.||.||||
  Rat     2 RDRLPDLTACRKSDDGDNAVIITVE-KDHFMDAFFHQVEEIRSSIARIAQHVEDVKKNHSIILSA 65

  Fly    68 PQTDEKTKQELEDLMADIKKNANRVRGKLKGIEQNIEQEEQQNKSSADLRIRKTQHSTLSRKFVE 132
            |..:.|.|:|||||..:|||.|||:|||||.|||:.:|:|..|::|.|||||:||||.||||||:
  Rat    66 PNPEGKIKEELEDLNKEIKKTANRIRGKLKAIEQSCDQDENGNRTSVDLRIRRTQHSVLSRKFVD 130

  Fly   133 VMTEYNRTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNSSVFTQGIIMETQQAKQTLAD 197
            ||||||..|..:|||.|||||||||||||.|.|:|||:|||.|..|:|...||.::|..:|.|.:
  Rat   131 VMTEYNEAQILFRERSKGRIQRQLEITGRTTTDEELEEMLESGKPSIFISDIISDSQITRQALNE 195

  Fly   198 IEARHQDIMKLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVEHAMDYVQTATQDTKKALKYQS 262
            ||:||:|||||||||:|||:|||||||.||:||||::.||.:|.:::|||:.|.::||||:||||
  Rat   196 IESRHKDIMKLETSIRELHEMFMDMAMFVETQGEMVNNIERNVVNSVDYVEHAKEETKKAIKYQS 260

  Fly   263 KARRKK-IMILICLTVLGILA 282
            |||||| |:..:.:.|:.:||
  Rat   261 KARRKKWIIAAVVVAVIAVLA 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 127/196 (65%)
SNARE 231..281 CDD:399038 25/50 (50%)
Stx2NP_036880.1 Syntaxin 31..228 CDD:279182 127/196 (65%)
SynN 31..182 CDD:238105 97/150 (65%)
SNARE_syntaxin2 192..260 CDD:277235 43/67 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353300
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 1 1.000 - - FOG0000185
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100497
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.620

Return to query results.
Submit another query.