DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx1A and syx-2

DIOPT Version :9

Sequence 1:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_510323.3 Gene:syx-2 / 181505 WormBaseID:WBGene00006372 Length:299 Species:Caenorhabditis elegans


Alignment Length:294 Identity:76/294 - (25%)
Similarity:154/294 - (52%) Gaps:12/294 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDRLAALHAAQSDDEEETEVA-VNVDGHDSYMDDFFAQVEEIRGMIDKVQDNVEEVKKKHSAILS 66
            :|||....:..:|..:|.|:: ........|:|..|   ||:|..|..|:..:|::::....:|:
 Worm     2 RDRLNEFQSRVTDRFDEVELSPARPPSAAEYVDRRF---EEVRNAIASVRGEIEKLRRDQQHVLA 63

  Fly    67 APQTDEKTKQELEDLMADIKKNANRVRGKLKGIEQNIEQEEQQNKSSADLRIRKTQHSTLSRKFV 131
            ....|.:.|..||:.:..|::....:|..::..|.:..:..:|.:|..:.|:|:.|...|.....
 Worm    64 LTIADPRDKNILENQIGTIRRRTGDLRKLVRQAEDDFLEFTKQVQSVTEKRMRQNQLELLKDNLN 128

  Fly   132 EVMTEYNRTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLE-EGNSSVFTQGIIMETQQAKQTL 195
            :::..:|.|..||:.|...|::|||:..|:...|:::.:::| .|:..:|.:.:...:...:...
 Worm   129 KLINLFNETHQDYKSRVSVRVRRQLQTVGQDLTDEDINRIMENSGSEQLFFREVNPLSVSGQAAY 193

  Fly   196 ADIEARHQDIMKLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVEHAMDYVQTATQDTKKALKY 260
            .|::.||.:|..||.:|..|.::|:|:..|.|:|.||:..|:.:||:.::.|:..:.:.|.|::|
 Worm   194 EDVKKRHGEIKDLENNIAMLEEIFLDLQHLTEAQDEMVTNIDNNVENGLEQVKQGSANVKTAVEY 258

  Fly   261 QSKARRKK-------IMILICLTVLGILAASYVS 287
            :..|.|||       |.||:.|.::.|:.|..:|
 Worm   259 KKSAMRKKICVAAILITILLILIIVAIILAVVLS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 48/197 (24%)
SNARE 231..281 CDD:399038 17/56 (30%)
syx-2NP_510323.3 SynN 30..178 CDD:238105 36/150 (24%)
Syntaxin 44..227 CDD:279182 43/182 (24%)
SNARE_syntaxin1-like 192..254 CDD:277201 19/61 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S873
OMA 1 1.010 - - QHG53912
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000185
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.