DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx1A and LOC103690878

DIOPT Version :9

Sequence 1:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_008771591.1 Gene:LOC103690878 / 103690878 RGDID:9098358 Length:297 Species:Rattus norvegicus


Alignment Length:296 Identity:79/296 - (26%)
Similarity:149/296 - (50%) Gaps:29/296 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDRLAAL-----HAAQSDDEEETEVAVNVDGH------DSYMDDFFAQVEEIRGMIDKVQDNVEE 56
            ||||..|     |...|.:.::|   :..|.|      .:.:::|..:|.|:...:.:::...:.
  Rat     2 KDRLEELKNHINHGTVSLELDDT---LMFDNHAFEKTETNTIEEFLQEVAELSLALTELEGLSQL 63

  Fly    57 VKKKHSAILSAPQTDE---KTKQELEDLMADIKKNANRVRGKLKGIEQNIEQEEQQNKSSADLRI 118
            :.||...:|.. .|:|   |.|.||..:.|.....|..::.:|..|:..:..:.:..:  |:.||
  Rat    64 IDKKQQGVLCC-TTEESVFKEKNELNIIKASFASQARLIQPQLSTIQHELATDCKYWR--AEHRI 125

  Fly   119 RKTQHSTLSRKFVEVMTEYNRTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNSSVFTQ- 182
            |::|.|.|...:..:::.:...:|....|.|.::.||.::.|....:::|||::.   :.|..| 
  Rat   126 RQSQLSFLLSHYRGIISHHYVCETQNMVRLKEKMVRQADLAGVKLQEEDLEKLVA---NPVPPQI 187

  Fly   183 -GIIMETQQAKQTLADIEARHQDIMKLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVEHAMDY 246
             |..::..:|||.||..|.|:|.:::||..|.||..:|..:...:..|.|::|.|||::....||
  Rat   188 VGRDLDVLKAKQGLALAEVRNQQLLELECQISELRTIFFQVETFISGQQELLDSIEYNILRTQDY 252

  Fly   247 VQTATQDTKKALKYQSKARRKKIMILICLTVLGILA 282
            |:.:.:..||||||:.::|    .:::..||.|:.|
  Rat   253 VEQSNETVKKALKYKRQSR----FLMVISTVAGLCA 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 49/201 (24%)
SNARE 231..281 CDD:399038 18/49 (37%)
LOC103690878XP_008771591.1 Syntaxin 40..228 CDD:279182 49/193 (25%)
SynN 41..176 CDD:294095 29/137 (21%)
SNARE_syntaxin1-like 201..262 CDD:277201 20/60 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.