DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx1A and stx2b

DIOPT Version :9

Sequence 1:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster
Sequence 2:XP_003199177.1 Gene:stx2b / 100536636 ZFINID:ZDB-GENE-091204-424 Length:309 Species:Danio rerio


Alignment Length:281 Identity:156/281 - (55%)
Similarity:218/281 - (77%) Gaps:2/281 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDRLAALHAAQSDDEEETEVAVNVDGHDSYMDDFFAQVEEIRGMIDKVQDNVEEVKKKHSAILSA 67
            :||||.|:..:.:..|:..|||:::.:| :|.|||.:|||:|.:|:|:...|:|||||:|.||||
Zfish     2 RDRLADLNVGRHNASEDGGVAVSMERND-FMQDFFQKVEEVRRVIEKISSLVDEVKKKYSVILSA 65

  Fly    68 PQTDEKTKQELEDLMADIKKNANRVRGKLKGIEQNIEQEEQQNKSSADLRIRKTQHSTLSRKFVE 132
            |..|||||:|||.|..:|||:||.|:..||.:.|::..:||.|::|.|.||:|||::.||.||||
Zfish    66 PNPDEKTKEELEQLTVEIKKHANYVQKSLKSMHQSLPSDEQVNQASVDARIQKTQYTNLSHKFVE 130

  Fly   133 VMTEYNRTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNSSVFTQGIIMETQQAKQTLAD 197
            |||:||..|..:||:.|.||||||||||:.|.::|||:|||.||.|:||..||.::|..:|.|.:
Zfish   131 VMTQYNEAQVSFREKSKSRIQRQLEITGKITTNEELEEMLETGNPSIFTSDIISDSQITRQALNE 195

  Fly   198 IEARHQDIMKLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVEHAMDYVQTATQDTKKALKYQS 262
            ||:|||||::||:|||||||||:|||||||:||||||.||.:|.:|::||..|..:||||::||:
Zfish   196 IESRHQDILRLESSIKELHDMFVDMAMLVETQGEMIDNIEKNVHNAVEYVGQAKVETKKAVRYQT 260

  Fly   263 KARRKKIMI-LICLTVLGILA 282
            :||||.|:: ||.|.|:.::|
Zfish   261 RARRKHIILALIVLVVVAVVA 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 117/196 (60%)
SNARE 231..281 CDD:399038 26/50 (52%)
stx2bXP_003199177.1 Syntaxin 31..228 CDD:279182 117/196 (60%)
SynN 31..182 CDD:238105 87/150 (58%)
SNARE_syntaxin2 192..260 CDD:277235 44/67 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595405
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 1 1.000 - - FOG0000185
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100497
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.