DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syx1A and stx11b.2

DIOPT Version :9

Sequence 1:NP_001189276.1 Gene:Syx1A / 42854 FlyBaseID:FBgn0013343 Length:296 Species:Drosophila melanogaster
Sequence 2:NP_001099072.1 Gene:stx11b.2 / 100005065 ZFINID:ZDB-GENE-050417-148 Length:288 Species:Danio rerio


Alignment Length:285 Identity:87/285 - (30%)
Similarity:147/285 - (51%) Gaps:34/285 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDRLAALHAAQSDD----EEET----EVAVNVDGHD--------SYMDDFFAQVEEIRGMIDKVQ 51
            :|||..|......:    |.||    ..:.|.|.:|        ..|:..|.:.:|.|..|..::
Zfish     2 RDRLGHLQEVSMSNGTVAEHETAHSLPASENTDLYDLPQDSSTNPDMEAVFDEAQEARRQIHYIR 66

  Fly    52 DNVEEVKKKHSAILSAPQTDEKTKQELEDLMADIKKNANRVRGKLKGIEQN-IEQEEQQNKSSAD 115
            ..|:.:::::|....:..::  |..:...:.||||.....:...|:.::.: .|.|.:...:|..
Zfish    67 LEVKRLREQNSHFFGSSASN--TTSDRNAIAADIKTRGQEMLTHLRNMDSHGKELESKYGVNSPV 129

  Fly   116 LRIRKTQHSTLSRKFVEVMTEYNRTQTDYRERCKGRIQRQLEITGRPTNDDELEKMLEEGNSSVF 180
            .||.:||:|::|..|.:.|.|||..:..::|.||..||||:||.||....|::|:|||.|..:||
Zfish   130 ARIAQTQYSSISNSFRDAMVEYNDAEMSHKESCKAYIQRQMEIVGRDVTGDQIEEMLESGQWNVF 194

  Fly   181 TQGIIMETQQAKQTLADIEARHQDIMKLETSIKELHDMFMDMAMLVESQGEMIDRIEYHVEHAMD 245
            ::.::.|.:.|:..|..||:||.::::||..||.||::|:|:|||||.|..|           .|
Zfish   195 SENMVSEGKTARSALIQIESRHTEMVQLERRIKSLHEVFLDVAMLVEEQSSM-----------TD 248

  Fly   246 YVQTATQDT----KKALKYQSKARR 266
            |:||..|.|    ::.|....:|:|
Zfish   249 YIQTNVQSTEAEVRQVLVKLERAKR 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syx1ANP_001189276.1 Syntaxin 33..230 CDD:395647 66/197 (34%)
SNARE 231..281 CDD:399038 10/40 (25%)
stx11b.2NP_001099072.1 Syntaxin 48..243 CDD:279182 66/196 (34%)
SynN 48..197 CDD:238105 46/150 (31%)
SNARE_syntaxin1-like 208..270 CDD:277201 27/72 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5074
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53912
OrthoDB 1 1.010 - - D1033833at2759
OrthoFinder 1 1.000 - - FOG0000185
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.