DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SMC1 and C44C10.10

DIOPT Version :10

Sequence 1:NP_651211.2 Gene:SMC1 / 42853 FlyBaseID:FBgn0040283 Length:1238 Species:Drosophila melanogaster
Sequence 2:NP_509954.1 Gene:C44C10.10 / 183458 WormBaseID:WBGene00008090 Length:127 Species:Caenorhabditis elegans


Alignment Length:51 Identity:16/51 - (31%)
Similarity:25/51 - (49%) Gaps:12/51 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LEYIEMENFKSYRGHIVVGPLKQFNAVIGPNGSGKSNFMDAISFVMGEKTS 77
            ||.::.|:|    |.|        ..:.||||.|||..:.||..:.|::.:
 Worm    62 LEDVKYESF----GKI--------TTITGPNGCGKSALVRAIGILTGDEVT 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SMC1NP_651211.2 SMC_N 26..1222 CDD:481474 16/51 (31%)
C44C10.10NP_509954.1 COG3950 50..>126 CDD:443150 16/51 (31%)

Return to query results.
Submit another query.