DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SMC1 and C44C10.5

DIOPT Version :9

Sequence 1:NP_651211.2 Gene:SMC1 / 42853 FlyBaseID:FBgn0040283 Length:1238 Species:Drosophila melanogaster
Sequence 2:NP_001359562.1 Gene:C44C10.5 / 183454 WormBaseID:WBGene00008086 Length:277 Species:Caenorhabditis elegans


Alignment Length:297 Identity:60/297 - (20%)
Similarity:128/297 - (43%) Gaps:52/297 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   852 KDTKKNVE---RWERSVQDEEDALEGLKL-------AEARYL-KEIDEDKEKMEKFKQDKQAKKQ 905
            :::|:.||   :.:..:|.|:.....|.|       .|.:.| |::.:::.|:...|..||::|.
 Worm     3 EESKQKVEKHTKMKELIQVEQGQFISLHLYRLFLNDLERKSLEKKLTKEQVKLTNIKASKQSQKV 67

  Fly   906 AVDDMEEDISK------------ARKDVANLAKEIHNVGSHLSAVESKIEAKKNERQNILLQAKT 958
            ...|..:.|:|            :|.|..:|::|.....:.:..:|:::..::.:|:.|:..   
 Worm    68 TKSDDPKAIAKQAPPAMFKVQGCSRLDGDSLSQENAEKPAIVIELENRLVQQRAQRRKIIAN--- 129

  Fly   959 DCIVVPLLRGSLDDAVRQSDPDVPSTSAAMENI-IEVDYSSLPREYTKLKDDSAFKKTH-EMLQK 1021
                           |...|.|:|:..|...:. ::.||||||.|..|..:|:...|.| ..|::
 Worm   130 ---------------VTLQDLDIPAKEAGTFSYDVKPDYSSLPDELKKESNDAETVKMHLRTLEE 179

  Fly  1022 DLQSKLD---VLERIQTPNMKALQKLDAVTEKVQSTNEEFENARKKAKRAKAAFERVKNERSSRF 1083
            .:|:..:   .:...:.|:|      ..:..:...|:.....|:.:....:|..|:||..|.:.|
 Worm   180 TIQATRNEWVAVNGAEYPDM------SNILIRFHETDSFINIAKLRTTELEAEIEQVKASRRTHF 238

  Fly  1084 VACCQHISDAIDGIYKKLARNEAAQAYIGPDNPEEPY 1120
            ......:|.::..||::::.:..:...:...|.:|||
 Worm   239 NQRLAAVSSSVSRIYREISEDPDSTVSLASSNEDEPY 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SMC1NP_651211.2 Smc 26..1216 CDD:224117 60/297 (20%)
ABC_SMC1_euk 27..>171 CDD:213242
SMC_hinge 535..653 CDD:214944
DUF4700 <697..>810 CDD:292399
ABC_SMC1_euk <1130..1232 CDD:213242
C44C10.5NP_001359562.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.