DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp68 and SLC9C2

DIOPT Version :9

Sequence 1:NP_524474.1 Gene:Hsp68 / 42852 FlyBaseID:FBgn0001230 Length:635 Species:Drosophila melanogaster
Sequence 2:XP_011507728.1 Gene:SLC9C2 / 284525 HGNCID:28664 Length:1129 Species:Homo sapiens


Alignment Length:209 Identity:38/209 - (18%)
Similarity:73/209 - (34%) Gaps:89/209 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 EISSMVLTKMK-----------ETAEAYLGTTV----KDAVITVPAYFNDSQRQATKDAG----- 159
            ||:.::|.|:|           .|.:.||...:    ||.:|.   :|.:..:.|..|:|     
Human   835 EINKVLLKKLKALNNFPKAIPPPTPDIYLHNIIWLEGKDVLID---FFKERAKLACFDSGDTICK 896

  Fly   160 ----------AIAGINVLRIINEPTAAALAYGLDKNLKGERNVLIFDLGGGTFDVSILTIDEGSL 214
                      .|:|:.:|..:: ||     :|::.|.:.:|         |:.|          :
Human   897 GGEMPQGIYLIISGMAILHSLS-PT-----FGIESNQRCDR---------GSRD----------M 936

  Fly   215 FEVRSTAGDTHLGGEDFDNRLVNHFAEEFKRKYKKDLRSNPRALRRLRTAAERAKRTLSSSTEAS 279
            |....|.||           ::...:...||:.:..:                   ...:|.:|.
Human   937 FTEFCTTGD-----------IIGELSCLLKREIEYTV-------------------ICETSLQAC 971

  Fly   280 -LEIDALYEGHDFY 292
             :.::.||||.|.:
Human   972 FISLEDLYEGFDAF 985

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp68NP_524474.1 PTZ00009 2..635 CDD:240227 38/209 (18%)
HSPA1-2_6-8-like_NBD 3..379 CDD:212675 38/209 (18%)
SLC9C2XP_011507728.1 Na_H_Exchanger 98..380 CDD:294713
Ion_trans 638..>731 CDD:278921
CAP_ED 873..980 CDD:237999 25/164 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0443
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.