DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6000 and AT4G24750

DIOPT Version :10

Sequence 1:NP_651210.3 Gene:CG6000 / 42851 FlyBaseID:FBgn0039145 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_194206.2 Gene:AT4G24750 / 828577 AraportID:AT4G24750 Length:292 Species:Arabidopsis thaliana


Alignment Length:118 Identity:34/118 - (28%)
Similarity:55/118 - (46%) Gaps:24/118 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KLLIDVREPEE-----LKETGQIPA---SINIPLGVVSQELA--------------ASEQLFKSK 99
            |.|:|||...|     :|.:..:|.   ..|:..|.:|:::.              :..:||.||
plant   105 KPLLDVRPSSERNKAWIKGSTWVPIFDNDDNLDAGTLSKKVTSFAMGGWWSGAPTLSFNRLFLSK 169

  Fly   100 YGREKPKPETEIIFHCKIGKRSLKAAEAAAALGFKNVKNYQGSWLDWAEREGL 152
            ...:.|| ::|:|..|:.|.|||.|.|.....|::|:...||. |:.|:.|.|
plant   170 VEEKFPK-DSELIVACQKGLRSLAACELLYNAGYENLFWVQGG-LESAQDEDL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6000NP_651210.3 RHOD_HSP67B2 43..148 CDD:238777 31/112 (28%)
AT4G24750NP_194206.2 PspE 86..223 CDD:440372 34/118 (29%)

Return to query results.
Submit another query.