DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pisd and PSD2

DIOPT Version :9

Sequence 1:NP_651208.1 Gene:Pisd / 42849 FlyBaseID:FBgn0026576 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_011686.1 Gene:PSD2 / 853080 SGDID:S000003402 Length:1138 Species:Saccharomyces cerevisiae


Alignment Length:281 Identity:71/281 - (25%)
Similarity:111/281 - (39%) Gaps:74/281 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 VNLSEAMYPEYEHYNSLAEFFTRPLKEGVRV--IDQQAPLVSPADGKVLHFGSASDSLIEQVKGV 240
            ::||:....:::.:|   |||.|.||.|.|:  .:.:..|.||||.:...|.:..:|....|||.
Yeast   858 LDLSQCRDKDFKTFN---EFFYRKLKPGSRLPESNNKEILFSPADSRCTVFPTIQESKEIWVKGR 919

  Fly   241 SYSIEDFLGPL--ETVEQANSGASYAQALKKKSDGSTELYQCVIYLAPGDYHRFHSP---TAWKP 300
            .:||:......  ||....|....                  :..|||.||||||||   |..||
Yeast   920 KFSIKKLANNYNPETFNDNNCSIG------------------IFRLAPQDYHRFHSPCNGTIGKP 966

  Fly   301 TIRRHFSGELLSVSPKVAGWLPGLFCLNERVLY-MGQWKHGFFSYTAVGATNVGSVEIYMDADLK 364
            .   :..||..:|:|........:|..|.||:. :...:.|...|..:||..|||:.:    ..|
Yeast   967 V---YVDGEYYTVNPMAVRSELDVFGENIRVIIPIDSPQFGKLLYIPIGAMMVGSILL----TCK 1024

  Fly   365 TNRWTGFNVGKHPPSTYEYDELVLNKELTEAPKEFGKGDLVGQFNMGSTIVLLFEAPKNFKF--D 427
            .|                        ::.|:.:|      :|.|..|.:.:::.....||.|  |
Yeast  1025 EN------------------------DVVESGQE------LGYFKFGGSTIIIIIPHNNFMFDSD 1059

  Fly   428 IIAGQK------IRVGESLGH 442
            ::....      ::||.|:||
Yeast  1060 LVKNSSERIETLVKVGMSIGH 1080

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PisdNP_651208.1 PLN02938 61..441 CDD:178526 69/278 (25%)
PS_Dcarbxylase 180..443 CDD:295959 71/279 (25%)
PSD2NP_011686.1 C2 19..>86 CDD:175973
MSCRAMM_ClfB <276..453 CDD:411414
PLN02964 523..1079 CDD:215520 69/278 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344874
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0688
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2148
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.690

Return to query results.
Submit another query.