DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pisd and PISD

DIOPT Version :9

Sequence 1:NP_651208.1 Gene:Pisd / 42849 FlyBaseID:FBgn0026576 Length:447 Species:Drosophila melanogaster
Sequence 2:NP_001313340.1 Gene:PISD / 23761 HGNCID:8999 Length:409 Species:Homo sapiens


Alignment Length:360 Identity:166/360 - (46%)
Similarity:211/360 - (58%) Gaps:23/360 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 TGFLLRWAPMGICVFGAIEW--QLQKNR---CEKEG---KPRTASELQSRIYCSLPLRIISRCWG 153
            |.||||..|:.:...|....  |.:|.|   .||.|   .|:.|...:..:|.|:|.|::||.||
Human    60 TMFLLRPLPILLVTGGGYAGYRQYEKYRERELEKLGLEIPPKLAGHWEVALYKSVPTRLLSRAWG 124

  Fly   154 WLAACYLPPSLRPYVYGWYSNTFDVNLSEAMYPEYEHYNSLAEFFTRPLKEGVRVIDQQAPLVSP 218
            .|....||..||..||..|..||.||:.||...:..||.:|:|||.|.||...|.:.....::||
Human   125 RLNQVELPHWLRRPVYSLYIWTFGVNMKEAAVEDLHHYRNLSEFFRRKLKPQARPVCGLHSVISP 189

  Fly   219 ADGKVLHFGSASDSLIEQVKGVSYSIEDFLGPLETVEQ-----ANSGASYAQALKKKSDGSTELY 278
            :||::|:||...:..:||||||:||:|.||||....|.     |.|..|:...|..:.  ..|||
Human   190 SDGRILNFGQVKNCEVEQVKGVTYSLESFLGPRMCTEDLPFPPAASCDSFKNQLVTRE--GNELY 252

  Fly   279 QCVIYLAPGDYHRFHSPTAWKPTIRRHFSGELLSVSPKVAGWLPGLFCLNERVLYMGQWKHGFFS 343
            .|||||||||||.|||||.|..:.||||.|.|:||:|.:|.|:..|||.||||:..|.|||||||
Human   253 HCVIYLAPGDYHCFHSPTDWTVSHRRHFPGSLMSVNPGMARWIKELFCHNERVVLTGDWKHGFFS 317

  Fly   344 YTAVGATNVGSVEIYMDADLKTNRWTGFNVGKHPPSTYEYDELVLNKELTEAPKEFGKGDLVGQF 408
            .||||||||||:.||.|.||.||.      .:|...:|.....|.:......|..  ||:.:|:|
Human   318 LTAVGATNVGSIRIYFDRDLHTNS------PRHSKGSYNDFSFVTHTNREGVPMR--KGEHLGEF 374

  Fly   409 NMGSTIVLLFEAPKNFKFDIIAGQKIRVGESLGHI 443
            |:||||||:|||||:|.|.:..|||||.||:||.:
Human   375 NLGSTIVLIFEAPKDFNFQLKTGQKIRFGEALGSL 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PisdNP_651208.1 PLN02938 61..441 CDD:178526 164/356 (46%)
PS_Dcarbxylase 180..443 CDD:295959 131/267 (49%)
PISDNP_001313340.1 PS_Dcarbxylase 151..407 CDD:295959 129/265 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152769
Domainoid 1 1.000 237 1.000 Domainoid score I2336
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H81653
Inparanoid 1 1.050 285 1.000 Inparanoid score I2858
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53621
OrthoDB 1 1.010 - - D1226492at2759
OrthoFinder 1 1.000 - - FOG0003152
OrthoInspector 1 1.000 - - oto89902
orthoMCL 1 0.900 - - OOG6_102081
Panther 1 1.100 - - LDO PTHR10067
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1016
SonicParanoid 1 1.000 - - X2547
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.