DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and SNP1

DIOPT Version :9

Sequence 1:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_012203.1 Gene:SNP1 / 854749 SGDID:S000001323 Length:300 Species:Saccharomyces cerevisiae


Alignment Length:258 Identity:64/258 - (24%)
Similarity:97/258 - (37%) Gaps:59/258 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 NLDSSVSEDLLIALFSTMGPVKSCKIIREPGNDPYAFIEYSNYQAATTALTAMNKRLFLE----- 72
            |.:.|...|.:..||....|:.    .:.|.:.|||..:.:........|.:.:.:.::|     
Yeast     2 NYNLSKYPDDVSRLFKPRPPLS----YKRPTDYPYAKRQTNPNITGVANLLSTSLKHYMEEFPEG 62

  Fly    73 ---------KEIKV--------------NWATSPGNQPK-TDISSHHHIFVGDLSPEIETETLRE 113
                     ::||:              ||  :|...|. .|...:..||:|.|..:::...|::
Yeast    63 SPNNHLQRYEDIKLSKIKNAQLLDRRLQNW--NPNVDPHIKDTDPYRTIFIGRLPYDLDEIELQK 125

  Fly   114 AFAPFGEISNCRIVRDPHTMKSKGYAFVSF---VKKAEAENAIQAMNGQWIGSR----SIRTNWS 171
            .|..||||...|||:|..|.|||||||:.|   :....|...|....|..|..|    .|....:
Yeast   126 YFVKFGEIEKIRIVKDKITQKSKGYAFIVFKDPISSKMAFKEIGVHRGIQIKDRICIVDIERGRT 190

  Fly   172 TRKLPPPREPSKGGGQGGGMGG-GPGN------GSGVKGSQRHTFEEVYNQSSP---TNTTVY 224
            .:...|.|       .|||:|| |..|      |.....|..:..|..|....|   |:::.|
Yeast   191 VKYFKPRR-------LGGGLGGRGYSNRDSRLPGRFASASTSNPAERNYAPRLPRRETSSSAY 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 64/258 (25%)
RRM1_TIA1_like 9..80 CDD:240798 15/94 (16%)
RRM2_TIA1_like 96..170 CDD:240799 29/80 (36%)
RRM3_TIA1_like 221..294 CDD:240800 1/4 (25%)
SNP1NP_012203.1 U1snRNP70_N 6..95 CDD:403437 15/94 (16%)
RRM_SNP1_like 89..201 CDD:410194 36/120 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.