Sequence 1: | NP_001262897.1 | Gene: | Rox8 / 42848 | FlyBaseID: | FBgn0005649 | Length: | 470 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_011471.1 | Gene: | RNA15 / 852838 | SGDID: | S000003012 | Length: | 296 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 214 | Identity: | 47/214 - (21%) |
---|---|---|---|
Similarity: | 84/214 - (39%) | Gaps: | 45/214 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 85 NQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEA 149
Fly 150 ENAIQAMNGQWIGSRSIRTNWS--------TRKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQR 206
Fly 207 HTFEEVYNQSSP---------TNTTVYCGGFPPNVISDDLMHK------HFVQFGPIQD-VRVFK 255
Fly 256 DKGFSFIK------FVTKE 268 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rox8 | NP_001262897.1 | ELAV_HUD_SF | 5..274 | CDD:273741 | 47/214 (22%) |
RRM1_TIA1_like | 9..80 | CDD:240798 | |||
RRM2_TIA1_like | 96..170 | CDD:240799 | 20/73 (27%) | ||
RRM3_TIA1_like | 221..294 | CDD:240800 | 15/61 (25%) | ||
RNA15 | NP_011471.1 | RRM_CSTF2_RNA15_like | 18..94 | CDD:409832 | 20/80 (25%) |
CSTF_C | 255..291 | CDD:405061 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0724 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |