DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and RNA15

DIOPT Version :9

Sequence 1:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_011471.1 Gene:RNA15 / 852838 SGDID:S000003012 Length:296 Species:Saccharomyces cerevisiae


Alignment Length:214 Identity:47/214 - (21%)
Similarity:84/214 - (39%) Gaps:45/214 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 NQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEA 149
            |.|.:.:     :::|.:..:...|.:.:..:..|.:.|.:::.||.|.:||||||:.|.....:
Yeast    13 NNPPSRV-----VYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESS 72

  Fly   150 ENAIQAMNGQWIGSRSIRTNWS--------TRKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQR 206
            .:|::.:||..:|||.::..:|        :::.........|.....|......||...:.|..
Yeast    73 ASAVRNLNGYQLGSRFLKCGYSSNSDISGVSQQQQQQYNNINGNNNNNGNNNNNSNGPDFQNSGN 137

  Fly   207 HTFEEVYNQSSP---------TNTTVYCGGFPPNVISDDLMHK------HFVQFGPIQD-VRVFK 255
            ..|   .:|..|         .|.|.     |..:||.:|..|      .|:|  ..|: .|...
Yeast   138 ANF---LSQKFPELPSGIDVNINMTT-----PAMMISSELAKKPKEVQLKFLQ--KFQEWTRAHP 192

  Fly   256 DKGFSFIK------FVTKE 268
            :...|.::      |||.|
Yeast   193 EDAVSLLELCPQLSFVTAE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 47/214 (22%)
RRM1_TIA1_like 9..80 CDD:240798
RRM2_TIA1_like 96..170 CDD:240799 20/73 (27%)
RRM3_TIA1_like 221..294 CDD:240800 15/61 (25%)
RNA15NP_011471.1 RRM_CSTF2_RNA15_like 18..94 CDD:409832 20/80 (25%)
CSTF_C 255..291 CDD:405061
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.