Sequence 1: | NP_001262897.1 | Gene: | Rox8 / 42848 | FlyBaseID: | FBgn0005649 | Length: | 470 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_010720.3 | Gene: | NPL3 / 852042 | SGDID: | S000002840 | Length: | 414 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 222 | Identity: | 50/222 - (22%) |
---|---|---|---|
Similarity: | 85/222 - (38%) | Gaps: | 60/222 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 LYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPGNDPYAFIEYSNYQAATTALTAMNKRLFLEK 73
Fly 74 EIKVNWATSPG--------NQPK----TDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRI 126
Fly 127 VRDPHTMKSKGYAFVSFVKKAEAENAIQAMNG-QWIGSRSIRTNWSTRKLPPPREPSKGG--GQG 188
Fly 189 GGMG---------------GGPGNGSG 200 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rox8 | NP_001262897.1 | ELAV_HUD_SF | 5..274 | CDD:273741 | 50/222 (23%) |
RRM1_TIA1_like | 9..80 | CDD:240798 | 18/70 (26%) | ||
RRM2_TIA1_like | 96..170 | CDD:240799 | 14/74 (19%) | ||
RRM3_TIA1_like | 221..294 | CDD:240800 | |||
NPL3 | NP_010720.3 | PHA03247 | <11..87 | CDD:223021 | |
RBD_RRM1_NPL3 | 126..192 | CDD:409777 | 18/69 (26%) | ||
RRM2_SRSF1_4_like | 200..271 | CDD:409776 | 17/95 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0724 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |