DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and NPL3

DIOPT Version :9

Sequence 1:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_010720.3 Gene:NPL3 / 852042 SGDID:S000002840 Length:414 Species:Saccharomyces cerevisiae


Alignment Length:222 Identity:50/222 - (22%)
Similarity:85/222 - (38%) Gaps:60/222 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPGNDPYAFIEYSNYQAATTALTAMNKRLFLEK 73
            |:|......|.|..|..:|...||:|..||:     :.:||:|:...::|..|:..::.:.|..:
Yeast   127 LFVRPFPLDVQESELNEIFGPFGPMKEVKIL-----NGFAFVEFEEAESAAKAIEEVHGKSFANQ 186

  Fly    74 EIKVNWATSPG--------NQPK----TDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRI 126
            .::|.::..|.        |.|:    .|:.        ||:.|...||      .|..:     
Yeast   187 PLEVVYSKLPAKRYRITMKNLPEGCSWQDLK--------DLARENSLET------TFSSV----- 232

  Fly   127 VRDPHTMKSKGYAFVSFVKKAEAENAIQAMNG-QWIGSRSIRTNWSTRKLPPPREPSKGG--GQG 188
                :|....|...:.|..:.....|::.:|. ::.|  |:.|.......||.|..::||  |:|
Yeast   233 ----NTRDFDGTGALEFPSEEILVEALERLNNIEFRG--SVITVERDDNPPPIRRSNRGGFRGRG 291

  Fly   189 GGMG---------------GGPGNGSG 200
            |..|               |||..|.|
Yeast   292 GFRGGFRGGFRGGFSRGGFGGPRGGFG 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 50/222 (23%)
RRM1_TIA1_like 9..80 CDD:240798 18/70 (26%)
RRM2_TIA1_like 96..170 CDD:240799 14/74 (19%)
RRM3_TIA1_like 221..294 CDD:240800
NPL3NP_010720.3 PHA03247 <11..87 CDD:223021
RBD_RRM1_NPL3 126..192 CDD:409777 18/69 (26%)
RRM2_SRSF1_4_like 200..271 CDD:409776 17/95 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.