DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and NOP6

DIOPT Version :9

Sequence 1:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_010068.1 Gene:NOP6 / 851313 SGDID:S000002372 Length:225 Species:Saccharomyces cerevisiae


Alignment Length:151 Identity:37/151 - (24%)
Similarity:58/151 - (38%) Gaps:46/151 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 PPPREPSKGGGQGG------------GMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGGF 228
            |..:.|:...|..|            |.||...||.  ||::               ..|:.|..
Yeast    38 PEGKRPNSAAGNDGEEPVKKKRKTRRGRGGKGKNGK--KGNR---------------FIVFVGSL 85

  Fly   229 PPNVISDDLMHKHFVQFGPIQDVRVFKDKGFSFIKF-VTKEAAAHAIEHTHNSEV--HGNLVKCF 290
            |.::.:.:|.: ||....|.| :|:..|||.:|::| ..|:..  .|:...:..:  ||.|:|  
Yeast    86 PRDITAVELQN-HFKNSSPDQ-IRLRADKGIAFLEFDADKDRT--GIQRRMDIALLQHGTLLK-- 144

  Fly   291 WGKE-------NGGDNSANNL 304
             .|:       .||.||...|
Yeast   145 -EKKINVELTVGGGGNSQERL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 26/110 (24%)
RRM1_TIA1_like 9..80 CDD:240798
RRM2_TIA1_like 96..170 CDD:240799
RRM3_TIA1_like 221..294 CDD:240800 20/75 (27%)
NOP6NP_010068.1 NARP1 <1..55 CDD:403685 4/16 (25%)
RRM_Nop6 78..151 CDD:409834 21/79 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.