DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and Y14

DIOPT Version :10

Sequence 1:NP_732944.2 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_564591.1 Gene:Y14 / 841576 AraportID:AT1G51510 Length:202 Species:Arabidopsis thaliana


Alignment Length:91 Identity:30/91 - (32%)
Similarity:47/91 - (51%) Gaps:7/91 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 IFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWI 161
            |.|..:..|.:.|.:..||..||||.|..:..|..:...||||.:.:.||.||::||.||||..:
plant    97 ILVSGVHEETQEEDITNAFGDFGEIKNLNLNLDRRSGYVKGYALIEYEKKEEAQSAISAMNGAEL 161

  Fly   162 GSRSIRTNWSTRKLPPPREPSKGGGQ 187
            .::::..:|:....|       .||:
plant   162 LTQNVSVDWAFSSGP-------SGGE 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_732944.2 RRM1_TIA1_like 9..80 CDD:409788
RRM2_TIA1_like 96..170 CDD:409789 26/72 (36%)
RRM_SF 221..292 CDD:473069
Y14NP_564591.1 RRM_RBM8 89..176 CDD:409762 27/78 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.