DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and RS40

DIOPT Version :10

Sequence 1:NP_732944.2 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_194280.1 Gene:RS40 / 828654 AraportID:AT4G25500 Length:350 Species:Arabidopsis thaliana


Alignment Length:209 Identity:48/209 - (22%)
Similarity:93/209 - (44%) Gaps:39/209 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 IFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWI 161
            :|.|:...:.....|...|..:|::...       .||: |:|||....:.:||:||:|::....
plant     4 VFCGNFEYDAREGDLERLFRKYGKVERV-------DMKA-GFAFVYMEDERDAEDAIRALDRFEF 60

  Fly   162 G--SRSIRTNWSTRKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVY 224
            |  .|.:|..|:        :..:||.:..| ||...:.|.::               |:.|...
plant    61 GRKGRRLRVEWT--------K
SERGGDKRSG-GGSRRSSSSMR---------------PSKTLFV 101

  Fly   225 CGGFPPNVISDDLMHKHFVQFGPIQDVRVFKDKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKC 289
            ......|..:.|| .|||..:|.|.:||:  .:.|:||::..:|.|..|::.::||::...::..
plant   102 INFDADNTRTRDL-EKHFEPYGKIVNVRI--RRNFAFIQYEAQEDATRALDASNNSKLMDKVISV 163

  Fly   290 FWGKENGGDNSANN 303
            .:..::  |::..|
plant   164 EYAVKD--DDARGN 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_732944.2 RRM1_TIA1_like 9..80 CDD:409788
RRM2_TIA1_like 96..170 CDD:409789 19/74 (26%)
RRM_SF 221..292 CDD:473069 19/70 (27%)
RS40NP_194280.1 RRM1_AtRSp31_like 2..73 CDD:409680 20/84 (24%)
RRM_SF 98..167 CDD:473069 19/71 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.