DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and RBP31

DIOPT Version :10

Sequence 1:NP_732944.2 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_194208.1 Gene:RBP31 / 828579 AraportID:AT4G24770 Length:329 Species:Arabidopsis thaliana


Alignment Length:184 Identity:52/184 - (28%)
Similarity:91/184 - (49%) Gaps:8/184 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPGNDP---YAFIEYSNYQAATTALT 63
            :.|:...|:||||...|:...|..||...|.|:..::|.....|.   :.|:..|:...|.||:.
plant   145 EPSEEAKLFVGNLAYDVNSQALAMLFEQAGTVEIAEVIYNRETDQSRGFGFVTMSSVDEAETAVE 209

  Fly    64 AMNKRLFLEKEIKVNWATSPGNQPKTDISSHH---HIFVGDLSPEIETETLREAFAPFGEISNCR 125
            ..|:.....:.:.||.|...|::|:.....:.   .::||:|..:::...|.:.|:..|::...|
plant   210 KFNRYDLNGRLLTVNKAAPRGSRPERAPRVYEPAFRVYVGNLPWDVDNGRLEQLFSEHGKVVEAR 274

  Fly   126 IVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPPR 179
            :|.|..|.:|:|:.||:.....|...||.|::||.:..|:||.|.:..:  |||
plant   275 VVYDRETGRSRGFGFVTMSDVDELNEAISALDGQNLEGRAIRVNVAEER--PPR 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_732944.2 RRM1_TIA1_like 9..80 CDD:409788 21/73 (29%)
RRM2_TIA1_like 96..170 CDD:409789 23/73 (32%)
RRM_SF 221..292 CDD:473069
RBP31NP_194208.1 DNA_pol_phi <87..150 CDD:461488 1/4 (25%)
RRM1_PSRP2_like 151..230 CDD:410188 22/78 (28%)
RRM 245..327 CDD:440488 27/84 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.