DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and AT4G09040

DIOPT Version :10

Sequence 1:NP_732944.2 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_192643.2 Gene:AT4G09040 / 826483 AraportID:AT4G09040 Length:304 Species:Arabidopsis thaliana


Alignment Length:203 Identity:54/203 - (26%)
Similarity:93/203 - (45%) Gaps:23/203 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDESQPKT-LYVGNLD-SSVSEDLLIALFSTMGPVKSCKII--REPGNDPYAFIEYSNYQAATTA 61
            ::|...|| |...|:. :|..||:. :||...|.|...::.  ::..|....|||.::.:.|.||
plant    87 VEEEISKTRLIAQNVPWTSTPEDIR-SLFEKYGSVIDIEMSMHKKERNRGLVFIEMASPEEAATA 150

  Fly    62 LTAMNKRLFLEKEIKVNWAT-------SPGNQPKTDISSHHHIFVGDLSPEIETETLREAF-APF 118
            |.::....:..:.:||::|.       :|...|..  ....::||.:|:.|...:.|:|.| |..
plant   151 LKSLESCEYEGRRLKVDYAKTKKKKTYAPRETPSP--VPTFNLFVANLAFEARAKHLKEFFDADT 213

  Fly   119 GEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTR--------KL 175
            |.:.:..::...:..:|.||.||||..|.:||.|:....|:....|.||...|.:        .|
plant   214 GNVVSTEVIFHENPRRSSGYGFVSFKTKKQAEAALIEFQGKDFLGRPIRLAKSKQFVKLQAKEGL 278

  Fly   176 PPPREPSK 183
            .||.|.::
plant   279 QPPEEEAE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_732944.2 RRM1_TIA1_like 9..80 CDD:409788 19/73 (26%)
RRM2_TIA1_like 96..170 CDD:409789 24/74 (32%)
RRM_SF 221..292 CDD:473069
AT4G09040NP_192643.2 RRM_SF 100..167 CDD:409669 17/67 (25%)
RRM 190..267 CDD:440488 24/76 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.