DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and UBA2A

DIOPT Version :9

Sequence 1:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001190109.1 Gene:UBA2A / 824853 AraportID:AT3G56860 Length:478 Species:Arabidopsis thaliana


Alignment Length:368 Identity:92/368 - (25%)
Similarity:132/368 - (35%) Gaps:92/368 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 HHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNG 158
            |..|||..|..:.:||||.|||..:|||.:|:.|.|..:.|||||.|:.:..::.|.||::....
plant   139 HRKIFVHGLGWDTKTETLIEAFKQYGEIEDCKAVFDKISGKSKGYGFILYKSRSGARNALKQPQK 203

  Fly   159 QWIGSRSIRTNWSTRKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTV 223
            : ||||......:::              |...||.|...:.|....:|      :.|..|...:
plant   204 K-IGSRMTACQLASK--------------GPVFGGAPIAAAAVSAPAQH------SNSEHTQKKI 247

  Fly   224 YCGGFPPNVISDDLMHKHFVQFGPIQ------DVRVFKDKGFSFIKFVTKEAAAHAIE------- 275
            |.......:....|: ..|.:||.|:      |....:.|||....:.:.|:|..|:|       
plant   248 YVSNVGAELDPQKLL-MFFSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFE 311

  Fly   276 --------------------HTHNSEV-------------------HGNLVKCFWGKENG-GDNS 300
                                |.||...                   ||:|:.   |...| |..:
plant   312 GHILHCQKAIDGPKPGKQQQHHHNPHAYNNPRYQRNDNNGYGPPGGHGHLMA---GNPAGMGGPT 373

  Fly   301 ANNLNAA--AAAAAASANVAAVAAANAAVAAGAGMPGQMMTQQQIAAATGAAIP----GQMMTPQ 359
            |..:|.|  .|..|..|:..|..|.|.|:  |..:.|.:.|...:....|..:|    .|.|.|.
plant   374 AQVINPAIGQALTALLASQGAGLAFNPAI--GQALLGSLGTAAGVNPGNGVGMPTGYGTQAMAPG 436

  Fly   360 QIAAQYPYAYQQMGYWYP-PATYPTTQMQTQYMQQGYYPYAYP 401
            .:.........|.||..| |.     |..|...|.|..||..|
plant   437 TMPGYGTQPGLQGGYQTPQPG-----QGGTSRGQHGVGPYGTP 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 51/185 (28%)
RRM1_TIA1_like 9..80 CDD:240798
RRM2_TIA1_like 96..170 CDD:240799 30/73 (41%)
RRM3_TIA1_like 221..294 CDD:240800 21/124 (17%)
UBA2ANP_001190109.1 PABP-1234 136..>347 CDD:130689 56/229 (24%)
RRM_SF 140..215 CDD:418427 30/75 (40%)
Med15 361..>465 CDD:312941 29/113 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.