DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and U11/U12-31K

DIOPT Version :10

Sequence 1:NP_732944.2 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_187651.1 Gene:U11/U12-31K / 820203 AraportID:AT3G10400 Length:261 Species:Arabidopsis thaliana


Alignment Length:99 Identity:22/99 - (22%)
Similarity:49/99 - (49%) Gaps:13/99 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 TSPGNQPKTDIS-------------SHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHT 132
            ::|.:||.:...             |...::|.:|...:....:...|:.||:::...:::|.||
plant    30 SNPKHQPSSSAKSSAPGGGSGGLAPSKSTLYVSNLDFSLTNSDIHTLFSTFGKVARVTVLKDRHT 94

  Fly   133 MKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSI 166
            .:|:|.|||.:|.:.:|..|.::|:.:.:..|.:
plant    95 RQSRGVAFVLYVSREDAAKAARSMDAKILNGRKL 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_732944.2 RRM1_TIA1_like 9..80 CDD:409788
RRM2_TIA1_like 96..170 CDD:409789 18/71 (25%)
RRM_SF 221..292 CDD:473069
U11/U12-31KNP_187651.1 RRM_ZCRB1 56..131 CDD:409827 18/73 (25%)
PTZ00368 154..>173 CDD:173561
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.