DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and AT3G09160

DIOPT Version :9

Sequence 1:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_187528.2 Gene:AT3G09160 / 820071 AraportID:AT3G09160 Length:132 Species:Arabidopsis thaliana


Alignment Length:77 Identity:25/77 - (32%)
Similarity:42/77 - (54%) Gaps:11/77 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 IETETLREAFAPFGEISNCRIVRDPHTMKSK--GYAFVSFVKKAEAENAIQAMNGQWIGSRSIRT 168
            :|:| |::.|:|.|||::..|   |.|..|.  .:||:.||.:..|:.|:| :||..:|..::  
plant    39 VESE-LKKLFSPCGEITDVHI---PETRNSSLWSHAFIYFVGEGTADKALQ-LNGSDMGGWTV-- 96

  Fly   169 NWSTRKLPPPRE 180
              .....|.|:|
plant    97 --DAEADPFPKE 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 25/77 (32%)
RRM1_TIA1_like 9..80 CDD:240798
RRM2_TIA1_like 96..170 CDD:240799 22/65 (34%)
RRM3_TIA1_like 221..294 CDD:240800
AT3G09160NP_187528.2 RRM_SF 25..93 CDD:302621 21/58 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1066369at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.