Sequence 1: | NP_001262897.1 | Gene: | Rox8 / 42848 | FlyBaseID: | FBgn0005649 | Length: | 470 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_084080.1 | Gene: | Hnrnpm / 76936 | MGIID: | 1926465 | Length: | 729 | Species: | Mus musculus |
Alignment Length: | 220 | Identity: | 53/220 - (24%) |
---|---|---|---|
Similarity: | 77/220 - (35%) | Gaps: | 61/220 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 LFSTMGPVKSCKIIREPGNDPYAFIEYSNYQAATTALTAMNKRLFLEKEIKVN------------ 78
Fly 79 ---WATSPG------------------NQPKTDISSHH---------HIFVGDLSPEIETETLRE 113
Fly 114 AFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRKLP-- 176
Fly 177 ---PPREPSK-GGGQGG-GMGGGPG 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rox8 | NP_001262897.1 | ELAV_HUD_SF | 5..274 | CDD:273741 | 53/220 (24%) |
RRM1_TIA1_like | 9..80 | CDD:240798 | 10/68 (15%) | ||
RRM2_TIA1_like | 96..170 | CDD:240799 | 22/73 (30%) | ||
RRM3_TIA1_like | 221..294 | CDD:240800 | |||
Hnrnpm | NP_084080.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..65 | ||
HnRNP_M | 40..69 | CDD:288396 | |||
RRM1_hnRNPM | 71..146 | CDD:241101 | 10/53 (19%) | ||
RRM2_hnRNPM_like | 205..278 | CDD:240832 | 22/73 (30%) | ||
27 X 6 AA repeats of [GEVSTPAN]-[ILMV]-[DE]-[RH]-[MLVI]-[GAV] | 399..607 | ||||
RRM3_hnRNPM | 653..729 | CDD:241105 | |||
RRM | <654..>729 | CDD:223796 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0724 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |