DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and SNRNP70

DIOPT Version :9

Sequence 1:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_003080.2 Gene:SNRNP70 / 6625 HGNCID:11150 Length:437 Species:Homo sapiens


Alignment Length:220 Identity:52/220 - (23%)
Similarity:87/220 - (39%) Gaps:51/220 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LIALFSTMGPVKSC----KIIREP-GNDPYAFI-----EYSNYQAATTALTAMNKRLFLEK---- 73
            |:|||:...|:...    |:..|. .|.||..|     |:.:.:.|.....|..:...:|:    
Human     9 LLALFAPRDPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERKRRE 73

  Fly    74 -----------EIKVNWATSPGNQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIV 127
                       |:|: |  .|.|.|.....:...:||..::.:.....||..|..:|.|....:|
Human    74 KIERRQQEVETELKM-W--DPHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMV 135

  Fly   128 RDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSI-------RT--NWSTRKLPPPREPSK 183
            ....:.|.:||||:.:..:.:..:|.:..:|:.|..|.:       ||  .|..|:|        
Human   136 YSKRSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVERGRTVKGWRPRRL-------- 192

  Fly   184 GGGQGGGMGGGPGNGSGVKGSQRHT 208
                |||:||....|:.|  :.||:
Human   193 ----GGGLGGTRRGGADV--NIRHS 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 52/220 (24%)
RRM1_TIA1_like 9..80 CDD:240798 17/81 (21%)
RRM2_TIA1_like 96..170 CDD:240799 19/82 (23%)
RRM3_TIA1_like 221..294 CDD:240800
SNRNP70NP_003080.2 U1snRNP70_N 3..93 CDD:403437 19/86 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..79 3/30 (10%)
Required for interaction with U1 RNA. /evidence=ECO:0000269|PubMed:2467746 92..202 29/121 (24%)
RRM_snRNP70 102..187 CDD:409682 19/84 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..437 12/39 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.