Sequence 1: | NP_001262897.1 | Gene: | Rox8 / 42848 | FlyBaseID: | FBgn0005649 | Length: | 470 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005617.2 | Gene: | SRSF4 / 6429 | HGNCID: | 10786 | Length: | 494 | Species: | Homo sapiens |
Alignment Length: | 202 | Identity: | 44/202 - (21%) |
---|---|---|---|
Similarity: | 77/202 - (38%) | Gaps: | 44/202 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 97 IFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWI 161
Fly 162 -GSRSIRTNWSTRKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYC 225
Fly 226 GGFPPNVISDDL--------MHKHFVQFGPIQDVRVFKD-KGFSFIKFVTKEAAAHAIEHTHNSE 281
Fly 282 VHGNLVK 288 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rox8 | NP_001262897.1 | ELAV_HUD_SF | 5..274 | CDD:273741 | 39/186 (21%) |
RRM1_TIA1_like | 9..80 | CDD:240798 | |||
RRM2_TIA1_like | 96..170 | CDD:240799 | 18/73 (25%) | ||
RRM3_TIA1_like | 221..294 | CDD:240800 | 16/77 (21%) | ||
SRSF4 | NP_005617.2 | RRM1_SRSF4_like | 3..72 | CDD:240783 | 18/83 (22%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 72..95 | 8/27 (30%) | |||
RRM2_SRSF4_like | 104..175 | CDD:241044 | 15/74 (20%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 169..494 | 0/3 (0%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0724 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |