DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and SRSF4

DIOPT Version :9

Sequence 1:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_005617.2 Gene:SRSF4 / 6429 HGNCID:10786 Length:494 Species:Homo sapiens


Alignment Length:202 Identity:44/202 - (21%)
Similarity:77/202 - (38%) Gaps:44/202 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 IFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWI 161
            :::|.||.:.....:...|..:|:|....:        ..||.||.|....:|::|:..:||:.:
Human     4 VYIGRLSYQARERDVERFFKGYGKILEVDL--------KNGYGFVEFDDLRDADDAVYELNGKDL 60

  Fly   162 -GSRSIRTNWSTRKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYC 225
             |.|.|        :...|.|.:.|..|.|.     :|.|.:.|.|..:       .|...|.| 
Human    61 CGERVI--------VEHARGPRRDGSYGSGR-----SGYGYRRSGRDKY-------GPPTRTEY- 104

  Fly   226 GGFPPNVISDDL--------MHKHFVQFGPIQDVRVFKD-KGFSFIKFVTKEAAAHAIEHTHNSE 281
                 .:|.::|        :..:..|.|.:......|. |....|:||:......|:|....:|
Human   105 -----RLIVENLSSRCSWQDLKDYMRQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTE 164

  Fly   282 VHGNLVK 288
            |:|..::
Human   165 VNGRKIR 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 39/186 (21%)
RRM1_TIA1_like 9..80 CDD:240798
RRM2_TIA1_like 96..170 CDD:240799 18/73 (25%)
RRM3_TIA1_like 221..294 CDD:240800 16/77 (21%)
SRSF4NP_005617.2 RRM1_SRSF4_like 3..72 CDD:240783 18/83 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..95 8/27 (30%)
RRM2_SRSF4_like 104..175 CDD:241044 15/74 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..494 0/3 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.