DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and SRSF3

DIOPT Version :9

Sequence 1:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_003008.1 Gene:SRSF3 / 6428 HGNCID:10785 Length:164 Species:Homo sapiens


Alignment Length:109 Identity:25/109 - (22%)
Similarity:44/109 - (40%) Gaps:28/109 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 IFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWI 161
            ::||:|........|..||..:|.:.:..:.|:|     .|:|||.|....:|.:|::.::|:.:
Human    12 VYVGNLGNNGNKTELERAFGYYGPLRSVWVARNP-----PGFAFVEFEDPRDAADAVRELDGRTL 71

  Fly   162 GSRSIRTNWST-----------------------RKLPPPREPS 182
            ....:|...|.                       |:.||||..|
Human    72 CGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRS 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 25/109 (23%)
RRM1_TIA1_like 9..80 CDD:240798
RRM2_TIA1_like 96..170 CDD:240799 18/72 (25%)
RRM3_TIA1_like 221..294 CDD:240800
SRSF3NP_003008.1 Sufficient for interaction with NXF1 1..90 19/82 (23%)
RRM_SRSF3 6..86 CDD:241089 19/78 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..164 7/35 (20%)
2 X approximate repeats, basic 119..164
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.