DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and myef2

DIOPT Version :9

Sequence 1:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001032500.1 Gene:myef2 / 641483 ZFINID:ZDB-GENE-051120-114 Length:557 Species:Danio rerio


Alignment Length:119 Identity:38/119 - (31%)
Similarity:54/119 - (45%) Gaps:12/119 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 IFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWI 161
            |||.:|..::..:.|:|.|...|.:....:..|... ||:|...|:|.:..||..||...|||.:
Zfish   214 IFVANLDFKVGWKKLKEVFGMAGTVRRADVKEDKDG-KSRGMGTVTFEQPLEAVQAISMFNGQML 277

  Fly   162 GSRSIRTNWSTRKLPP------PREPSKGGGQGG-GMGGGPG----NGSGVKGS 204
            ..|.:......:.|||      .:.|....|.|| |||.|||    |.:.:.||
Zfish   278 FDRQMHVKMDDKSLPPDDFRPVEKSPQLPRGLGGIGMGLGPGGQPINANCLSGS 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 38/119 (32%)
RRM1_TIA1_like 9..80 CDD:240798
RRM2_TIA1_like 96..170 CDD:240799 22/72 (31%)
RRM3_TIA1_like 221..294 CDD:240800
myef2NP_001032500.1 RRM1_MYEF2 82..157 CDD:241102
RRM2_hnRNPM_like 214..287 CDD:240832 22/73 (30%)
RRM <436..>557 CDD:223796
RRM3_MYEF2 481..557 CDD:241106
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.