Sequence 1: | NP_001262897.1 | Gene: | Rox8 / 42848 | FlyBaseID: | FBgn0005649 | Length: | 470 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001356237.1 | Gene: | Srsf4 / 57317 | MGIID: | 1890577 | Length: | 496 | Species: | Mus musculus |
Alignment Length: | 200 | Identity: | 47/200 - (23%) |
---|---|---|---|
Similarity: | 78/200 - (39%) | Gaps: | 39/200 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 100 GDLSPEIETETLREAFAPFGEISNCRIVRDP-HTMKSKGYAFVSFVKKAEAENAIQAMNGQWI-G 162
Fly 163 SRSIRTNWSTRKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQSSPTNTTVYCGG 227
Fly 228 FPPNVISDDL--------MHKHFVQFGPIQDVRVFKD-KGFSFIKFVTKEAAAHAIEHTHNSEVH 283
Fly 284 GNLVK 288 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rox8 | NP_001262897.1 | ELAV_HUD_SF | 5..274 | CDD:273741 | 42/184 (23%) |
RRM1_TIA1_like | 9..80 | CDD:240798 | |||
RRM2_TIA1_like | 96..170 | CDD:240799 | 21/71 (30%) | ||
RRM3_TIA1_like | 221..294 | CDD:240800 | 16/76 (21%) | ||
Srsf4 | NP_001356237.1 | RRM_SF | <42..77 | CDD:388407 | 11/42 (26%) |
RRM2_SRSF4_like | 109..180 | CDD:241044 | 15/73 (21%) | ||
U2AF_lg | 250..>361 | CDD:273727 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0724 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |