DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and hnrnpm

DIOPT Version :9

Sequence 1:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:XP_005170511.1 Gene:hnrnpm / 555643 ZFINID:ZDB-GENE-030131-6898 Length:715 Species:Danio rerio


Alignment Length:130 Identity:33/130 - (25%)
Similarity:60/130 - (46%) Gaps:16/130 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 QPKTDISSHHHIFVGDLSPEIETETLREAF-APFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEA 149
            :|.::.:..:.:||.::..:::.:||::.. ...||::....:.|... ||:|.|.|.|..:...
Zfish    39 EPYSNPNKRYSVFVSNIPYDVKWQTLKDLMKEKVGEVTYVEHLMDGEG-KSRGCAVVEFRTEELM 102

  Fly   150 ENAIQAMNGQWIGSRSIRTNWSTRKLPPPRE--------------PSKGGGQGGGMGGGPGNGSG 200
            :.|::.:|...:..|.::.......:...||              |..|||.|||||||.|.|.|
Zfish   103 KKAVEKVNKHVMNGRPLKVKEDPDGVISQREANRGHGGGGGGGGPPGMGGGMGGGMGGGMGGGMG 167

  Fly   201  200
            Zfish   168  167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 33/130 (25%)
RRM1_TIA1_like 9..80 CDD:240798
RRM2_TIA1_like 96..170 CDD:240799 16/74 (22%)
RRM3_TIA1_like 221..294 CDD:240800
hnrnpmXP_005170511.1 RRM <19..>122 CDD:223796 17/83 (20%)
HnRNP_M 20..47 CDD:288396 1/7 (14%)
RRM1_hnRNPM 49..124 CDD:241101 16/75 (21%)
RRM <215..>309 CDD:223796
RRM2_hnRNPM 233..308 CDD:241103
RRM3_hnRNPM 639..715 CDD:241105
RRM <640..>715 CDD:223796
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.