DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and TRNAU1AP

DIOPT Version :9

Sequence 1:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_060316.1 Gene:TRNAU1AP / 54952 HGNCID:30813 Length:287 Species:Homo sapiens


Alignment Length:316 Identity:80/316 - (25%)
Similarity:132/316 - (41%) Gaps:78/316 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TLYVGNLDSSVSEDLLIALFSTMG-PVKSCKIIRE-----PGNDPYAFIEYSNYQAATTALTAMN 66
            :|::|:|:..:.|:.:...|:||| .|.|.||||.     |..  |.|:|:::...|...|..:|
Human     4 SLWMGDLEPYMDENFISRAFATMGETVMSVKIIRNRLTGIPAG--YCFVEFADLATAEKCLHKIN 66

  Fly    67 KR----LFLEKEIKVNWATSPGNQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCR-- 125
            .:    ....|..|:|:||. |.||  |.|..:.:|||||:|:::...|.|.|...  ..:||  
Human    67 GKPLPGATPAKRFKLNYATY-GKQP--DNSPEYSLFVGDLTPDVDDGMLYEFFVKV--YPSCRGG 126

  Fly   126 -IVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQ-WIGSRSIRTNWSTRKLPPPREPSKGGGQG 188
             :|.| .|..||||.||.|..:.|.:.|:....|. .:||:.:|.:.:..|....:.        
Human   127 KVVLD-QTGVSKGYGFVKFTDELEQKRALTECQGAVGLGSKPVRLSVAIPKASRVKP-------- 182

  Fly   189 GGMGGGPGNGSGVKGSQRHTFEEVYNQ------------SSPTNTTVYCGGFPPNVISDDLMHKH 241
                        |:.||.:::.  |||            ....||..|...:|            
Human   183 ------------VEYSQMYSYS--YNQYYQQYQNYYAQWGYDQNTGSYSYSYP------------ 221

  Fly   242 FVQFGPIQD-VRVFKDKGFSFI-----KFVTKEAAAHAIEHTHNSEVHGNLVKCFW 291
              |:|..|. ::.:::.|...:     :....||....:|  .:.|::..|:.|.|
Human   222 --QYGYTQSTMQTYEEVGDDALEDPMPQLDVTEANKEFME--QSEELYDALMDCHW 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 75/297 (25%)
RRM1_TIA1_like 9..80 CDD:240798 24/80 (30%)
RRM2_TIA1_like 96..170 CDD:240799 27/77 (35%)
RRM3_TIA1_like 221..294 CDD:240800 14/77 (18%)
TRNAU1APNP_060316.1 RRM1_SECp43 4..87 CDD:410022 26/85 (31%)
RRM2_SECp43 95..176 CDD:410024 27/83 (33%)
Trnau1ap <205..284 CDD:407550 15/85 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1842
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.