DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and rbm8a

DIOPT Version :10

Sequence 1:NP_732944.2 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001013363.1 Gene:rbm8a / 503767 ZFINID:ZDB-GENE-050306-51 Length:174 Species:Danio rerio


Alignment Length:89 Identity:30/89 - (33%)
Similarity:46/89 - (51%) Gaps:1/89 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 IFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWI 161
            :||..:..|...|.:.:.||.||||.|..:..|..|...||||.|.:....||:.|::.:|||.:
Zfish    75 LFVTGVHEEATEEDVHDKFAEFGEIKNLHLNLDRRTGYLKGYALVEYETYKEAQAAMEGLNGQEL 139

  Fly   162 GSRSIRTNWSTRKLPPPREPSKGG 185
            ..:.|..:|...: .||:...:||
Zfish   140 MGQPISVDWCFVR-GPPKSKRRGG 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_732944.2 RRM1_TIA1_like 9..80 CDD:409788
RRM2_TIA1_like 96..170 CDD:409789 25/72 (35%)
RRM_SF 221..292 CDD:473069
rbm8aNP_001013363.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70
RRM_RBM8 67..154 CDD:409762 26/79 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..174 4/13 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.