| Sequence 1: | NP_001262897.1 | Gene: | Rox8 / 42848 | FlyBaseID: | FBgn0005649 | Length: | 470 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001003875.1 | Gene: | snrnp70 / 445398 | ZFINID: | ZDB-GENE-040825-2 | Length: | 495 | Species: | Danio rerio |
| Alignment Length: | 206 | Identity: | 54/206 - (26%) |
|---|---|---|---|
| Similarity: | 84/206 - (40%) | Gaps: | 45/206 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 23 LIALFSTMGPV----KSCKIIREP-GNDPYA----FIEY----SNYQAATTALT----------- 63
Fly 64 AMNKR-LFLEKEIKVNWATSPGNQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIV 127
Fly 128 RDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSI-------RT--NWSTRKLPPPREPSK 183
Fly 184 GGGQGGGMGGG 194 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Rox8 | NP_001262897.1 | ELAV_HUD_SF | 5..274 | CDD:273741 | 54/206 (26%) |
| RRM1_TIA1_like | 9..80 | CDD:240798 | 20/81 (25%) | ||
| RRM2_TIA1_like | 96..170 | CDD:240799 | 21/82 (26%) | ||
| RRM3_TIA1_like | 221..294 | CDD:240800 | |||
| snrnp70 | NP_001003875.1 | U1snRNP70_N | 2..>57 | CDD:289024 | 12/47 (26%) |
| RRM | <98..>182 | CDD:223796 | 19/83 (23%) | ||
| RRM_snRNP70 | 102..187 | CDD:240682 | 21/84 (25%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0724 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||