DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and B52

DIOPT Version :9

Sequence 1:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001014619.2 Gene:B52 / 41670 FlyBaseID:FBgn0004587 Length:355 Species:Drosophila melanogaster


Alignment Length:231 Identity:50/231 - (21%)
Similarity:86/231 - (37%) Gaps:55/231 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPGNDPYAFIEYSNYQAATTALTAMNKRLFLEK 73
            :|||.|...|.|..|...|...|..:...|     .:.|.|:|:.:|:.|..|:..:|.:..|.:
  Fly     6 VYVGGLPYGVRERDLERFFKGYGRTRDILI-----KNGYGFVEFEDYRDADDAVYELNGKELLGE 65

  Fly    74 EIKVNWA--TSPG-NQPKTD------------------------------ISSHHHIFVGDLSPE 105
            .:.|..|  |:.| |:.:.|                              :.:.:.:.|.:||..
  Fly    66 RVVVEPARGTARGSNRDRYDDRYGGRRGGGGGRYNEKNKNSRSSSRYGPPLRTEYRLIVENLSSR 130

  Fly   106 IETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNW 170
            :..:.|::.....||::    ..|.|..: :....|.|...::.:.||:.::...:..|.|..  
  Fly   131 VSWQDLKDYMRQAGEVT----YADAHKQR-RNEGVVEFASLSDMKTAIEKLDDTELNGRRIHL-- 188

  Fly   171 STRKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQR 206
                    .|..:||..||  |||.|.|.....|.|
  Fly   189 --------VEDRRGGRSGG--GGGSGRGRSRSSSSR 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 50/231 (22%)
RRM1_TIA1_like 9..80 CDD:240798 19/70 (27%)
RRM2_TIA1_like 96..170 CDD:240799 14/73 (19%)
RRM3_TIA1_like 221..294 CDD:240800
B52NP_001014619.2 RRM1_SRSF4_like 5..74 CDD:240783 20/72 (28%)
RRM2_SRSF4_like 120..191 CDD:241044 14/85 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.