DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and rump

DIOPT Version :9

Sequence 1:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster


Alignment Length:404 Identity:74/404 - (18%)
Similarity:137/404 - (33%) Gaps:116/404 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 HHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNG 158
            |:.:||.:|..:::.:.|::.|...|::.:..:..|... .|:|:|.:.:....||..||..::.
  Fly   231 HNKVFVANLDYKVDNKKLKQVFKLAGKVQSVDLSLDKEG-NSRGFAVIEYDHPVEAVQAISMLDR 294

  Fly   159 QWIGSR--SIRTNWSTRKLPPPRE----PSKGGGQGGGMG---------------GGPGN----G 198
            |.:..|  ::|.:    ::|...|    |...||.|.|:|               ||...    |
  Fly   295 QMLFDRRMTVRLD----RIPDKNEGIKLPEGLGGVGIGLGPNGEPLRDVAHNLPNGGQSQGQLLG 355

  Fly   199 SGVKGSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFG-----------PIQDVR 252
            :..:|||..:.....|.|:.:|.|.       |:::    :...|.||           |:|...
  Fly   356 NAQQGSQLGSVGSQPNSSAVSNATT-------NLLN----NLTGVMFGNHAAVQPSPVAPVQKPS 409

  Fly   253 VFKDKGFSFIKFVTKEAAAHAIEHTHNSEVHGNLVKCFWGKENGG------DNSANNLNAAAAAA 311
            :..:.|...:..       :.:..:..:.|.|||     |.:.|.      .:|.:||......:
  Fly   410 LGNNTGSGGLNL-------NNLNPSILAAVVGNL-----GNQGGNLSNPLLSSSLSNLGLNLGNS 462

  Fly   312 AASANV--AAVAAANAAVAAGAGMPGQMMTQQQIAAATGAAIPGQMMTPQQIAAQYPYAYQQMGY 374
            ....|:  :.|..:|...:.|.|......:....:...|::                    .:||
  Fly   463 GNDDNLPPSNVGLSNNYSSGGTGGGNSYSSGNNYSGGGGSS--------------------NLGY 507

  Fly   375 WYPPATYPTTQMQTQYMQQGYYPYAYPTSAQQAGGVPCIQFSAAGYRMVPPNVAWGVPGTVVPGV 439
                                   .||.:|....||...:......|....|...:| .|:.|...
  Fly   508 -----------------------NAYSSSGGMGGGNGGVGVDGNDYNTGNPLDVYG-GGSNVGNS 548

  Fly   440 TAAAASAAAAANGS 453
            ...:|:|..|:..|
  Fly   549 NVGSANAVGASRKS 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 43/215 (20%)
RRM1_TIA1_like 9..80 CDD:240798
RRM2_TIA1_like 96..170 CDD:240799 17/75 (23%)
RRM3_TIA1_like 221..294 CDD:240800 13/83 (16%)
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 44/226 (19%)
RRM1_hnRNPM_like 58..133 CDD:240831
RRM2_hnRNPM_like 234..307 CDD:240832 17/73 (23%)
RRM <543..>631 CDD:223796 5/20 (25%)
RRM_SF 565..630 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.