DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and CG2931

DIOPT Version :9

Sequence 1:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_649552.1 Gene:CG2931 / 40673 FlyBaseID:FBgn0037342 Length:302 Species:Drosophila melanogaster


Alignment Length:188 Identity:53/188 - (28%)
Similarity:87/188 - (46%) Gaps:21/188 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SQPK------TLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPGNDPYA--FIEYSNYQAATT 60
            |.||      :::|..:.::.|.|:....|.....:|..| ..:.|.:|.|  .|:.:...:|..
  Fly    99 SAPKLYQCRQSVHVPTVAAAPSIDINAVSFDVTQKLKKLK-AEKSGPNPIAEEAIKAARASSALQ 162

  Fly    61 ALTAMNKRLFLEKEIKVN----WA-TSPGNQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGE 120
            :.....::....|.:::.    |. ||..:.|..|.    .||.|||..::..|.|...|..|..
  Fly   163 SFQTTERKKKDRKTVRIAGGTVWEDTSLADWPDDDF----RIFCGDLGNDVNDEVLTRTFNKFPS 223

  Fly   121 ISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSI---RTNWSTRKL 175
            ....|:|||..|.||||:.||||.:.|:...|::.|:|:::|||.|   ::.|..|.|
  Fly   224 FQRARVVRDKRTGKSKGFGFVSFREPADFIRAMKEMDGRYVGSRPIKLRKSTWRQRSL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 52/187 (28%)
RRM1_TIA1_like 9..80 CDD:240798 12/76 (16%)
RRM2_TIA1_like 96..170 CDD:240799 30/76 (39%)
RRM3_TIA1_like 221..294 CDD:240800
CG2931NP_649552.1 RRM_RBM42 192..274 CDD:240829 32/85 (38%)
RRM <194..>280 CDD:223796 33/89 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.