Sequence 1: | NP_001262897.1 | Gene: | Rox8 / 42848 | FlyBaseID: | FBgn0005649 | Length: | 470 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005157471.1 | Gene: | srsf1a / 406288 | ZFINID: | ZDB-GENE-040426-1950 | Length: | 257 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 59/199 - (29%) |
---|---|---|---|
Similarity: | 90/199 - (45%) | Gaps: | 31/199 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 92 SSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKG---YAFVSFVKKAEAENAI 153
Fly 154 QAMNGQWIGSRSIRTNWSTRKLPPPREPSKG---GGQGGGMGGGPGNGSGVKGSQRHTFEEVYNQ 215
Fly 216 SSPTNTTVY---CGGFPPNVISDDLMHKHFVQFGPIQDVRVFKDKGFSFIKFVTKEAAAHAIEHT 277
Fly 278 HNSE 281 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rox8 | NP_001262897.1 | ELAV_HUD_SF | 5..274 | CDD:273741 | 57/190 (30%) |
RRM1_TIA1_like | 9..80 | CDD:240798 | |||
RRM2_TIA1_like | 96..170 | CDD:240799 | 23/76 (30%) | ||
RRM3_TIA1_like | 221..294 | CDD:240800 | 18/64 (28%) | ||
srsf1a | XP_005157471.1 | RRM | <7..>87 | CDD:223796 | 24/80 (30%) |
RRM1_SRSF1 | 16..89 | CDD:241041 | 23/85 (27%) | ||
RRM | <123..>189 | CDD:223796 | 19/68 (28%) | ||
RRM2_SRSF1_like | 130..202 | CDD:241045 | 18/61 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0724 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |