DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and fne

DIOPT Version :9

Sequence 1:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001096965.1 Gene:fne / 32245 FlyBaseID:FBgn0086675 Length:356 Species:Drosophila melanogaster


Alignment Length:347 Identity:90/347 - (25%)
Similarity:144/347 - (41%) Gaps:86/347 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DESQPKTLYVGNLDSSVSEDLLIALFSTMGPVKSCKIIRE--PGN----------DP-------- 46
            |||: ..|.|..|..:::::.:.:|||::|.::|||::|:  .||          :|        
  Fly    22 DESR-TNLIVNYLPQTMTQEEMRSLFSSIGELESCKLVRDKVSGNLVLPASLTALNPALQQGQSL 85

  Fly    47 -YAFIEYSNYQAATTALTAMNKRLFLEKEIKVNWATSPGNQPKTDISSHHHIFVGDLSPEIETET 110
             |.|:.|...:.|..|:..:|......|.|||::|     :|.::.....:::|..|...:....
  Fly    86 GYGFVNYVRAEDAEKAVNTLNGLRLQNKVIKVSYA-----RPSSESIKGANLYVSGLPKNLSQPD 145

  Fly   111 LREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQ---------WIGSRSI 166
            |...||.||:|...||:.|..:..|||..|:.|.::.|||.|||.:||:         .:...:.
  Fly   146 LEGMFASFGKIITSRILCDNISGLSKGVGFIRFDQRNEAERAIQELNGKTPKGYAEPITVKFANN 210

  Fly   167 RTNWSTRKLPPPRE------------------PSKGGGQGGGMGGG-------PGNGSGVKGSQR 206
            .:|.:..::.||..                  ||.|..:...:.|.       |||  .:.||..
  Fly   211 PSNSAKAQIAPPLTAYLTPQAAAATRRLAGALPSAGRIRYSPLAGDLLANSILPGN--AMTGSGW 273

  Fly   207 HTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFKD------KGFSFIKFV 265
            ..|  |||.:..|...|....|.|              ||.:|.|:|.:|      |||.|:...
  Fly   274 CIF--VYNLAPETEENVLWQLFGP--------------FGAVQSVKVIRDLQTSKCKGFGFVTMT 322

  Fly   266 TKEAAAHAIEHTHNSEVHGNLV 287
            ..:.|..||: :.|....||.|
  Fly   323 NYDEAVVAIQ-SLNGYTLGNRV 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 81/329 (25%)
RRM1_TIA1_like 9..80 CDD:240798 24/91 (26%)
RRM2_TIA1_like 96..170 CDD:240799 24/82 (29%)
RRM3_TIA1_like 221..294 CDD:240800 20/73 (27%)
fneNP_001096965.1 ELAV_HUD_SF 23..354 CDD:273741 89/346 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.