DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and elav

DIOPT Version :9

Sequence 1:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001245447.1 Gene:elav / 31000 FlyBaseID:FBgn0260400 Length:483 Species:Drosophila melanogaster


Alignment Length:343 Identity:90/343 - (26%)
Similarity:136/343 - (39%) Gaps:85/343 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPGN---DP-------------YAFIEYSNYQA 57
            |.|..|..:::||.:.:|||::|.::|.|:||:...   ||             |.|:.|...|.
  Fly   151 LIVNYLPQTMTEDEIRSLFSSVGEIESVKLIRDKSQVYIDPLNPQAPSKGQSLGYGFVNYVRPQD 215

  Fly    58 ATTALTAMNKRLFLEKEIKVNWATSPGNQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEIS 122
            |..|:..:|......|.|||::|     :|.:|.....:::|..|...:..:.|...|||||.|.
  Fly   216 AEQAVNVLNGLRLQNKTIKVSFA-----RPSSDAIKGANLYVSGLPKTMTQQELEAIFAPFGAII 275

  Fly   123 NCRIVRDP-HTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGS-------RSIRTNWSTRKLPPPR 179
            ..||:::. :..::||..|:.|.|:.||..||.|:||....|       :...|..||.|:..|:
  Fly   276 TSRILQNAGNDTQTKGVGFIRFDKREEATRAIIALNGTTPSSCTDPIVVKFSNTPGSTSKIIQPQ 340

  Fly   180 EP-------------------SKGGGQGGGMGGG------PGNGSGVKGSQRHTFEE-------- 211
            .|                   :||..:...|.|.      | ||.|...:...|...        
  Fly   341 LPAFLNPQLVRRIGGAMHTPVNKGLARFSPMAGDMLDVMLP-NGLGAAAAAATTLASGPGGAYPI 404

  Fly   212 -VYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFKD------KGFSFIKFVTKEA 269
             :||.:..|........|.|              ||.:|.|::.||      ||:.|:.....:.
  Fly   405 FIYNLAPETEEAALWQLFGP--------------FGAVQSVKIVKDPTTNQCKGYGFVSMTNYDE 455

  Fly   270 AAHAIEHTHNSEVHGNLV 287
            ||.|| ...|....||.|
  Fly   456 AAMAI-RALNGYTMGNRV 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 84/328 (26%)
RRM1_TIA1_like 9..80 CDD:240798 26/86 (30%)
RRM2_TIA1_like 96..170 CDD:240799 25/81 (31%)
RRM3_TIA1_like 221..294 CDD:240800 19/73 (26%)
elavNP_001245447.1 ELAV_HUD_SF 146..483 CDD:273741 90/343 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.