DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and Srsf5

DIOPT Version :9

Sequence 1:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:XP_038967784.1 Gene:Srsf5 / 29667 RGDID:3664 Length:270 Species:Rattus norvegicus


Alignment Length:222 Identity:36/222 - (16%)
Similarity:84/222 - (37%) Gaps:65/222 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPGNDPYAFIEYSNYQAATTALTAMNKRLFLEK 73
            :::|.|:.:..|..:...|...|.::...:.|     .:.|:|:.:.:.|..|:..::.:....:
  Rat     6 VFIGRLNPAAREKDVERFFKGYGRIRDIDLKR-----GFGFVEFEDPRDADDAVYELDGKELCSE 65

  Fly    74 EIKVNWATS---------------PGNQPKTD------ISSHHHIFVGDLSPEIETETLREAFAP 117
            .:.:..|.:               ...:|:.|      :.:.:.:.|.:||..:..:.|::....
  Rat    66 RVTIEHARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTENRLIVENLSSRVSWQDLKDFMRQ 130

  Fly   118 FGEISNCRIVRDPHTMK-SKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPPREP 181
            .||::    ..|.|..| ::|  .|.|....:.:|||:.::|:.|..|.|:.             
  Rat   131 AGEVT----FADAHRPKLNEG--VVEFASYGDLKNAIEKLSGKEINGRKIKL------------- 176

  Fly   182 SKGGGQGGGMGGGPGNGSGVKGSQRHT 208
                               ::||:||:
  Rat   177 -------------------IEGSKRHS 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 36/222 (16%)
RRM1_TIA1_like 9..80 CDD:240798 10/70 (14%)
RRM2_TIA1_like 96..170 CDD:240799 19/74 (26%)
RRM3_TIA1_like 221..294 CDD:240800
Srsf5XP_038967784.1 RRM1_SRSF5 5..74 CDD:410008 11/72 (15%)
RRM2_SRSF5 99..179 CDD:410158 19/117 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.