DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and Srsf9

DIOPT Version :9

Sequence 1:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:XP_038945194.1 Gene:Srsf9 / 288701 RGDID:1309495 Length:247 Species:Rattus norvegicus


Alignment Length:281 Identity:57/281 - (20%)
Similarity:87/281 - (30%) Gaps:102/281 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPGNDPYAFIEYSNYQAATTALTAMNKRLFLEK 73
            :|||||.:.|.|..|..||...|.::..::....|..|:||:.:.:.:....|||..|.      
  Rat    16 IYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRHGLRALTGRNS------ 74

  Fly    74 EIKVNWATSPGNQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGY 138
                                                                        ||:..
  Rat    75 ------------------------------------------------------------KSQRS 79

  Fly   139 AFVSF-VKKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPPREPSKGGGQGGGMGGGPGNGSGVK 202
            ||:.. :...:||:||...||...|...:|..:       ||       ..||.||.|.......
  Rat    80 AFLWLPLLVTDAEDAIYGRNGYDYGQCRLRVEF-------PR-------AYGGRGGWPRASRNGP 130

  Fly   203 GSQRHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFKDKGFSFIKFVTK 267
            .::|..|.            |...|.||:....|| ..|..:.|.:....|.|| |...::::.|
  Rat   131 PTRRSDFR------------VLVSGLPPSGSWQDL-KDHMREAGDVCYADVQKD-GMGMVEYLRK 181

  Fly   268 EAAAHAIE-------HTHNSE 281
            |...:|:.       .:|..|
  Rat   182 EDMEYALRKLDDTKFRSHEGE 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 54/265 (20%)
RRM1_TIA1_like 9..80 CDD:240798 19/70 (27%)
RRM2_TIA1_like 96..170 CDD:240799 12/74 (16%)
RRM3_TIA1_like 221..294 CDD:240800 17/68 (25%)
Srsf9XP_038945194.1 RRM1_SRSF9 15..112 CDD:241042 31/161 (19%)
RRM2_SRSF9 129..212 CDD:410161 19/88 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.