DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and RBMX

DIOPT Version :10

Sequence 1:NP_732944.2 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_002130.2 Gene:RBMX / 27316 HGNCID:9910 Length:391 Species:Homo sapiens


Alignment Length:167 Identity:47/167 - (28%)
Similarity:76/167 - (45%) Gaps:18/167 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 IFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWI 161
            :|:|.|:.|...:.|...|..:|.|....:::|..|.||:|:|||:|...|:|::|.:.|||:.:
Human    10 LFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSL 74

  Fly   162 GSRSIRTNWST-------RKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRH-------TFEEV 212
            ..::|:...:|       |:.|||  |.:..|...|:.||.|...|.:|....       .:...
Human    75 DGKAIKVEQATKPSFESGRRGPPP--PPRSRGPPRGLRGGRGGSGGTRGPPSRGGHMDDGGYSMN 137

  Fly   213 YNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQ 249
            :|.||.........|.||.  |.....|.....||::
Human   138 FNMSSSRGPLPVKRGPPPR--SGGPPPKRSAPSGPVR 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_732944.2 RRM1_TIA1_like 9..80 CDD:409788
RRM2_TIA1_like 96..170 CDD:409789 24/72 (33%)
RRM_SF 221..292 CDD:473069 7/29 (24%)
RBMXNP_002130.2 RRM_RBMX_like 7..86 CDD:409816 24/75 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..391 29/116 (25%)
dnaA 165..>306 CDD:455861 2/8 (25%)
RBM1CTR 173..217 CDD:400429 47/167 (28%)
Necessary for the association to nascent RNAPII transcripts and nuclear localization 186..236
Necessary for RNA-binding 333..391
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.