DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and rnp-9

DIOPT Version :9

Sequence 1:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001359585.1 Gene:rnp-9 / 182350 WormBaseID:WBGene00007396 Length:312 Species:Caenorhabditis elegans


Alignment Length:224 Identity:85/224 - (37%)
Similarity:120/224 - (53%) Gaps:25/224 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 ATSPGNQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFV 144
            |:.|..:.:.|.|.|.|:||||||.::..|.|:..|..|||:|..:::||..|.|||||.||||.
 Worm    72 ASEPPMEMRIDTSKHFHVFVGDLSKDVSNELLKSTFTKFGEVSEAKVIRDVQTQKSKGYGFVSFP 136

  Fly   145 KKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPPREPSKGGGQGGGMGGGPGNGSGVKGSQRHTF 209
            .|..|||||..|||:|||.|::||||:.||                        :..:...:.||
 Worm   137 NKQNAENAIAGMNGKWIGKRAVRTNWAARK------------------------NSEENRDKLTF 177

  Fly   210 EEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFKDKGFSFIKFVTKEAAAHAI 274
            |:|:|.:...||:||.|.........|| ...|..:|.|.:||:||.:.::|:::..||.|..||
 Worm   178 EQVFNSTKADNTSVYVGNISQQTTDADL-RDLFSTYGDIAEVRIFKTQRYAFVRYEKKECATKAI 241

  Fly   275 EHTHNSEVHGNLVKCFWGKENGGDNSANN 303
            ...:..|:.||.|:|.||:.....|.|.|
 Worm   242 MEMNGKEMAGNQVRCSWGRTQAVPNQALN 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 73/193 (38%)
RRM1_TIA1_like 9..80 CDD:240798 85/224 (38%)
RRM2_TIA1_like 96..170 CDD:240799 41/73 (56%)
RRM3_TIA1_like 221..294 CDD:240800 26/72 (36%)
rnp-9NP_001359585.1 RRM2_TIA1_like 88..162 CDD:240799 41/73 (56%)
RRM3_TIA1_like 189..260 CDD:240800 25/71 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 59 1.000 Domainoid score I7055
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1066369at2759
OrthoFinder 1 1.000 - - FOG0000924
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.