DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and Hnrnpm

DIOPT Version :9

Sequence 1:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_001103381.1 Gene:Hnrnpm / 116655 RGDID:620369 Length:729 Species:Rattus norvegicus


Alignment Length:220 Identity:53/220 - (24%)
Similarity:77/220 - (35%) Gaps:61/220 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LFSTMGPVKSCKIIREPGNDPYAFIEYSNYQAATTALTAMNKRLFLEKEIKVN------------ 78
            |....|..:.|           |.:|:...::...|...:||.....:.:||.            
  Rat   103 LMDAEGKSRGC-----------AVVEFKMEESMKKAAEVLNKHSLSGRPLKVKEDPDGEHARRAM 156

  Fly    79 ---WATSPG------------------NQPKTDISSHH---------HIFVGDLSPEIETETLRE 113
               .||:.|                  |.|.......|         .:||.:|..::..:.|:|
  Rat   157 QKVMATTGGMGMGPGGPGMINIPPSILNNPNIPNEIIHALQAGRLGSTVFVANLDYKVGWKKLKE 221

  Fly   114 AFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRKLP-- 176
            .|:..|.:....|:.|... ||:|...|:|.:..||..||...|||.:..|.:......|.||  
  Rat   222 VFSMAGVVVRADILEDKDG-KSRGIGTVTFEQSIEAVQAISMFNGQLLFDRPMHVKMDERALPKG 285

  Fly   177 ---PPREPSK-GGGQGG-GMGGGPG 196
               ||..|.: ..|.|| |||.|||
  Rat   286 DFFPPERPQQLPHGLGGIGMGLGPG 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 53/220 (24%)
RRM1_TIA1_like 9..80 CDD:240798 10/68 (15%)
RRM2_TIA1_like 96..170 CDD:240799 22/73 (30%)
RRM3_TIA1_like 221..294 CDD:240800
HnrnpmNP_001103381.1 HnRNP_M 40..69 CDD:402915
RRM1_hnRNPM 71..146 CDD:410058 10/53 (19%)
RRM2_hnRNPM 203..278 CDD:410060 22/75 (29%)
antiphage_ZorA_3 <413..552 CDD:411477
RRM3_hnRNPM 653..729 CDD:410062
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.