DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and Srsf9

DIOPT Version :9

Sequence 1:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:NP_079849.1 Gene:Srsf9 / 108014 MGIID:104896 Length:222 Species:Mus musculus


Alignment Length:213 Identity:51/213 - (23%)
Similarity:81/213 - (38%) Gaps:50/213 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 WATSPGNQPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSF 143
            ||...|.:      ....|:||:|..::..:.|.:.|..:|.|....: ::.|.:..  :|||.|
Mouse     5 WADERGGE------GDGRIYVGNLPSDVREKDLEDLFYKYGRIREIEL-KNRHGLVP--FAFVRF 60

  Fly   144 VKKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPPREPSKGGGQGG---GMGGGPGNGSGVKGSQ 205
            ....:||:||...||...|...:|..:          |...||:||   |...||       .::
Mouse    61 EDPRDAEDAIYGRNGYDYGQCRLRVEF----------PRTYGGRGGWPRGARNGP-------PTR 108

  Fly   206 RHTFEEVYNQSSPTNTTVYCGGFPPNVISDDLMHKHFVQFGPIQDVRVFKDKGFSFIKFVTKEAA 270
            |..|.            |...|.||:....|| ..|..:.|.:....|.|| |...::::.||..
Mouse   109 RSDFR------------VLVSGLPPSGSWQDL-KDHMREAGDVCYADVQKD-GMGMVEYLRKEDM 159

  Fly   271 AHAIE-------HTHNSE 281
            .:|:.       .:|..|
Mouse   160 EYALRKLDDTKFRSHEGE 177

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 48/197 (24%)