DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and LOC100490872

DIOPT Version :9

Sequence 1:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:XP_002932728.2 Gene:LOC100490872 / 100490872 -ID:- Length:449 Species:Xenopus tropicalis


Alignment Length:184 Identity:55/184 - (29%)
Similarity:91/184 - (49%) Gaps:22/184 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ESQPKT--LYVGNLDSSVSEDLLIALFSTMGPVKSCKIIREPGND-----PYAFIEYSNYQAATT 60
            ||:.||  :||.|....:.||   ..|...|  .|.|||   .||     .:..:.::..:.|..
 Frog    40 ESKTKTCPIYVKNFVKEIDED---DFFGKCG--ASTKII---NNDCGQQTEFGLLPFNKQKDAIR 96

  Fly    61 ALTAM-NKRLFL-EKEIKVNWATSPGNQPKTDISSHH---HIFVGDLSPEIETETLREAFAPFGE 120
            |:..| ...::| :.:||....|....:|:......:   :::|.:||.||:...|.:.|||||.
 Frog    97 AVDKMKGMDIYLAQAKIKEKRQTEFSKKPEPLHKPRYNSVNLYVKNLSYEIDDYRLNKEFAPFGI 161

  Fly   121 ISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRK 174
            |::.:::|:..  :|||:.||.|...|||..|:..|||:.:.|:.:...|:.||
 Frog   162 ITSAKVMREGG--RSKGFGFVCFSTPAEARKALSGMNGKILASKPLYVAWAQRK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 53/182 (29%)
RRM1_TIA1_like 9..80 CDD:240798 19/77 (25%)
RRM2_TIA1_like 96..170 CDD:240799 27/73 (37%)
RRM3_TIA1_like 221..294 CDD:240800
LOC100490872XP_002932728.2 PABP-1234 <7..431 CDD:130689 55/184 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.