DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rox8 and hnrnpm

DIOPT Version :9

Sequence 1:NP_001262897.1 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster
Sequence 2:XP_004911113.1 Gene:hnrnpm / 100489127 XenbaseID:XB-GENE-993962 Length:744 Species:Xenopus tropicalis


Alignment Length:151 Identity:38/151 - (25%)
Similarity:63/151 - (41%) Gaps:21/151 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 IFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWI 161
            :||.:|...:..:.|:|.|...|.:....::.|... ||:|...|::.:..||..||...|||.:
 Frog   245 VFVANLDYSVGWKKLKEVFGIAGTVVRADVLEDKDG-KSRGIGTVTYEQPIEAVQAISMFNGQPL 308

  Fly   162 GSRSIRTNWSTRKLP---------PPREPSKGGGQGGGM--GGGPGNGSGVKGSQRHTFEEVYNQ 215
            ..|.:......:.:|         ||:.|...||.|.|:  ||.|.:.:.::||         ..
 Frog   309 FDRPMMVKMDDKSMPKGDLFPADRPPQLPRGLGGIGMGLGPGGQPIDANHLRGS---------TM 364

  Fly   216 SSPTNTTVYCGGFPPNVISDD 236
            ..|...::...||..|.:..|
 Frog   365 GGPGGMSMDSMGFGMNKMGID 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rox8NP_001262897.1 ELAV_HUD_SF 5..274 CDD:273741 38/151 (25%)
RRM1_TIA1_like 9..80 CDD:240798
RRM2_TIA1_like 96..170 CDD:240799 20/72 (28%)
RRM3_TIA1_like 221..294 CDD:240800 4/16 (25%)
hnrnpmXP_004911113.1 HnRNP_M 48..72 CDD:371586
RRM1_hnRNPM 74..149 CDD:241101
PABP-1234 76..>388 CDD:130689 38/151 (25%)
RRM2_hnRNPM_like 245..318 CDD:240832 20/73 (27%)
RRM3_hnRNPM 668..744 CDD:241105
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.