DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spas and PEX6

DIOPT Version :9

Sequence 1:NP_651206.3 Gene:spas / 42846 FlyBaseID:FBgn0039141 Length:758 Species:Drosophila melanogaster
Sequence 2:NP_014070.1 Gene:PEX6 / 855387 SGDID:S000005273 Length:1030 Species:Saccharomyces cerevisiae


Alignment Length:297 Identity:102/297 - (34%)
Similarity:153/297 - (51%) Gaps:33/297 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   480 VEWTDIAGQDVAKQALQEMVILPSVRPELFTGLRAPAKGLLLFGPPGNGKTLLARAVATECSATF 544
            |.|.||.|.|..|..:.:.:.:|...|||||.......|:|.:||||.||||:|:|:||..|..|
Yeast   729 VTWDDIGGIDFVKGEILDTIDMPLKHPELFTSGMKKRSGILFYGPPGTGKTLMAKAIATNFSLNF 793

  Fly   545 LNISAASLTSKYVGDGEKLVRALFAVARHMQPSIIFIDEVDSLLSERSSSEHEAS--RRLKTEFL 607
            .::....|.:.|:|:.|..||.:|..||..:|.:||.||:||:..:|.:......  .|:.::.|
Yeast   794 FSVKGPELLNMYIGESEANVRRVFQKAREAKPCVIFFDEIDSVAPKRGNQGDSGGVMDRIVSQLL 858

  Fly   608 VEFDGLPGNPDGDRIVVLAATNRPQELDEAALR--RFTKRVYVSLPDEQTREL-LLNRLLQKQGS 669
            .|.||:  :.|.|.:.|:.|||||..||||.||  ||.|.:|:.:||..|::| :|..|.:|  .
Yeast   859 AELDGM--STDADGVFVIGATNRPDLLDEALLRPGRFDKLLYLGIPDTDTKQLNILEALTRK--F 919

  Fly   670 PLDTEA-LRRLAKITD-GYSGSDLTALAKDAALEPIREL-----------------NVEQVKCLD 715
            .||.:. |..|||:.. .|:|:|..||..||.|..:..:                 |:...:..|
Yeast   920 VLDNDVKLIELAKLCPFNYTGADFYALCSDAMLNAMSRIARMVEKKVSQHNELTGENISTRRWFD 984

  Fly   716 ISAMRAITE-----QDFHSSLKRIRRSVAPQSLNSYE 747
            ..|.:..|:     :||..:.:::..||:...||.||
Yeast   985 KIATKEDTKVVVKMEDFLKAQEQLTPSVSRAELNHYE 1021

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spasNP_651206.3 MIT_spastin 230..308 CDD:239142
P-loop_NTPase 482..>538 CDD:304359 24/55 (44%)
AAA 515..652 CDD:214640 56/140 (40%)
AAA 519..650 CDD:278434 55/134 (41%)
Vps4_C <722..754 CDD:286426 9/31 (29%)
PEX6NP_014070.1 SpoVK 540..1017 CDD:223540 98/291 (34%)
RecA-like_PEX6_r2 740..899 CDD:410935 62/160 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.